1. Recombinant Proteins
  2. Others
  3. RPE Protein, Human (His)

RPE Protein, Human (His)

Cat. No.: HY-P71264
Handling Instructions

The RPE Protein is responsible for catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE Protein, Human (His) is the recombinant human-derived RPE protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RPE Protein is responsible for catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE Protein, Human (His) is the recombinant human-derived RPE protein, expressed by E. coli , with C-6*His labeled tag.

Background

The RPE Protein, an enzyme, plays a crucial role in the metabolism of vitamin A. It converts retinol to retinaldehyde, which is essential for vision. In addition, RPE Protein inhibits tumor growth and may have potential therapeutic applications in treating certain conditions.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q96AT9-1 (M1-R228)

Gene ID
Molecular Construction
N-term
RPE (M1-R228)
Accession # Q96AT9-1
6*His
C-term
Synonyms
Ribulose-Phosphate 3-Epimerase; Ribulose-5-Phosphate-3-Epimerase; RPE; HUSSY-17
AA Sequence

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RPE Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RPE Protein, Human (His)
Cat. No.:
HY-P71264
Quantity:
MCE Japan Authorized Agent: