1. Recombinant Proteins
  2. Others
  3. SCN3B Protein, Human (HEK293, His)

SCN3B Protein, Human (HEK293, His)

Cat. No.: HY-P76635
COA Handling Instructions

The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, His) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-His labeled tag. The total length of SCN3B Protein, Human (HEK293, His) is 137 a.a., with molecular weight of 23-34 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $80 In-stock
50 μg $212 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, His) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-His labeled tag. The total length of SCN3B Protein, Human (HEK293, His) is 137 a.a., with molecular weight of 23-34 kDa, respectively.

Background

SCN3B protein plays a crucial role in modulating the kinetics of channel gating, resulting in distinctive persistent sodium currents. In comparison to the beta-1 subunit, SCN3B induces a slower inactivation of sodium channels, influencing their opening dynamics. The interaction of SCN3B with NFASC suggests its potential involvement in directing sodium channels to the nodes of Ranvier during axonal development and retaining them at these nodes in mature myelinated axons. The voltage-sensitive sodium channel, comprising an ion-conducting pore-forming alpha-subunit, is intricately regulated by beta-1, beta-2, beta-3, and/or beta-4 subunits. Notably, beta-1 and beta-3 associate non-covalently with alpha, while beta-2 and beta-4 form covalent bonds through disulfide linkages, contributing to the functional complexity of the sodium channel complex.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NY72 (F23-E159)

Gene ID
Molecular Construction
N-term
SCN3B (F23-E159)
Accession # Q9NY72
His
C-term
Synonyms
Sodium channel subunit beta-3; SCN3B; KIAA1158
AA Sequence

FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSE

Molecular Weight

Approximately 23-34 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SCN3B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCN3B Protein, Human (HEK293, His)
Cat. No.:
HY-P76635
Quantity:
MCE Japan Authorized Agent: