1. Recombinant Proteins
  2. Others
  3. SNCG Protein, Human

SNCG Protein, Human

Cat. No.: HY-P71043
COA Handling Instructions

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free. The total length of SNCG Protein, Human is 127 a.a., with molecular weight of 16-18 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $30 In-stock
50 μg $86 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free. The total length of SNCG Protein, Human is 127 a.a., with molecular weight of 16-18 kDa.

Background

SNCG protein plays a crucial role in maintaining neurofilament network integrity, suggesting involvement in shaping axonal architecture during both developmental stages and adulthood. Additionally, it may contribute to modulating the keratin network in the skin. In vitro studies indicate that SNCG increases the susceptibility of neurofilament-H to calcium-dependent proteases, implying a role in regulating neurofilament dynamics. Furthermore, SNCG activates the MAPK and Elk-1 signal transduction pathway and exhibits potential centrosome association. Its interaction with MYOC influences MYOC secretion and aggregation, highlighting SNCG's diverse involvement in cellular processes with implications for neuronal and skin-related functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O76070 (M1-D127)

Gene ID
Molecular Construction
N-term
SNCG (M1-D127)
Accession # O76070
C-term
Synonyms
Gamma-Synuclein; Breast Cancer-Specific Gene 1 Protein; Persyn; Synoretin; SR; SNCG; BCSG1; PERSYN; PRSN
AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Molecular Weight

16-18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SNCG Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SNCG Protein, Human
Cat. No.:
HY-P71043
Quantity:
MCE Japan Authorized Agent: