2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. TFF1 Protein, Human (HEK293, His)

TFF1 Protein, Human (HEK293, His)

Cat. No.: HY-P71072
COA Handling Instructions

TFF1 protein acts as an endogenous repressor of isoform 1 and interacts with CHK1, antagonizing its function and promoting the transition from the S to G2/M phase of the cell cycle. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of TFF1 Protein, Human (HEK293, His) is 60 a.a., with molecular weight of ~8.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $88 In-stock
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF1 protein acts as an endogenous repressor of isoform 1 and interacts with CHK1, antagonizing its function and promoting the transition from the S to G2/M phase of the cell cycle. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of TFF1 Protein, Human (HEK293, His) is 60 a.a., with molecular weight of ~8.1 kDa.
Background

Lastly, CDC25 acts as an endogenous repressor of isoform 1 and interacts with and antagonizes CHK1, promoting the transition from the S to G2/M phase of the cell cycle.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

P04155 (E25-F84)
Gene ID
Molecular Construction
N-term
TFF1 (E25-F84)
Accession # P04155
6*His
C-term
Synonyms
Trefoil factor 1; Breast cancer estrogen-inducible protein; PNR-2; Polypeptide P1.A; hP1.A; Protein Ps2; TFF1; BCEI; PS2
AA Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Molecular Weight

Approximately 8.1 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.
Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

N/A.
Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping

Shipping with dry ice.
Documentation

COA (220 KB)

Handling Instructions (2659 KB)

TFF1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71072
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.