From 11:00 pm to 12:00 pm EST ( 8:00 pm to 9:00 pm PST ) on January 6th, the website will be under maintenance. We are sorry for the inconvenience. Please arrange your schedule properly.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Resorcinolnaphthalein is a specific angiotensin-converting enzyme 2(ACE2) enhancer and activates ACE2 activity with an EC50 value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis .
ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACE2 Rat Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the ACE2 PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .
SSAA09E2 is an inhibitor of SARS-CoV (Severe acute respiratory syndrome-Coronavirus) replication, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2) .
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 μM [2].
SARS-CoV-2-IN-65 (compound 2f (81)) is a potent,orally active and reversible SARS-CoV-2 entry inhibitor. SARS-CoV-2-IN-65 inhibits the pseudovirus entry in a ACE2-dependent pathway, via mainly inhibiting RBD:ACE2 interaction and TMPRSS2 activity in Calu-3 cells .
MAT-POS-e194df51-1 is an orally active, non-covalent and non-peptide SARS-CoV-2 main protease (M pro) inhibitor with an IC50 value of 37nM. MAT-POS-e194df51-1 is cytotoxic with EC50 values of 64 nM and 126 nM in A549-ACE2-TMPRSS2 cells and HeLa -ACE2 cells, respectively .
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC50 of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC50 of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC50 of 52 µM [2].
Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels .
Garcinone B, a xanthone derivative, is a nature product that could be isolated from the pericarp of Mangosteen. Garcinone B is a potent ACE2 and Mpro inhibitor. Garcinone B can be used in research of COVID-19 .
DX600 is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity [2] .
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
DX600 TFA is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity [2] .
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment .
Methylprednisolone-d3 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d4 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d7 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d2 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19 .
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
Methylprednisolone (Standard) is the analytical standard of Methylprednisolone. This product is intended for research and analytical applications. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels .
ML2006a4 is an orally active inhibitor for SARS-CoV-2 main protease (M pro) with IC50 in picomolare value. ML2006a4 is cell permeable and antiviral active, that inhibits replication in SARS-CoV-2 in cells Huh7.5.1-ACE2-TMPRSS2 (Huh7.5.1++) in picomolare level
BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2(ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties [2].
CMX990 is a SARS-CoV-2 3CL protease inhibitor. The EC90s for inhibiting SARS-CoV-2 were 9.6 nM and 101 nM in human bronchial epithelial cells (HBECs) and HeLa-ACE2 cells, respectively. CMX990 has good ADME and pharmacokinetic properties .
Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity [2] .
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis . (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection [2].
Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2(ACE2) activator and has strong and potent anti-inflammatory properties [2] .
BMS-265246 is a potent and selective cyclin-dependent kinaseCDK1 and CDK2 inhibitor, with IC50 values of 6 and 9 nM, respectively. BMS-265246 inhibits CHI3L1 (chitinase 3-like-1) stimulation of ACE2 (angiotensin converting enzyme 2) and SPP (viral spike protein priming proteases). BMS-265246 can be used for ovarian cancer and COVID-19 research [2] .
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2(CK2). Anti-inflammatory and anticancer effects [2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
SARS-CoV-2 3CLpro-IN-23 (Compound Cd3) is a compound that can be isolated from Citrus depressa. SARS-CoV-2 3CLpro-IN-23 has good inhibitory activity to the SARS-CoV-2 spike protein, with KD of 0.79 μM. SARS-CoV-2 3CLpro-IN-23 can bind to key amino acid residue, disrupting the formation of the spike protein and h-ACE2 complex .
SARS-CoV-2-IN-81 (compound 12e) is a potent AAK1 inhibitor with an IC50 value of 9.38 nM. SARS-CoV-2-IN-81 shows anti-viral property against SARS-CoV-2. SARS-CoV-2-IN-81 attenuates AAK1-induced phosphorylation of AP2M1 threonine 156 and disrupts the direct interaction between AP2M1 and ACE2, ultimately inhibiting SARS-CoV-2 infection .
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2(CK2). Anti-inflammatory and anticancer effects [2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
Ursodeoxycholic acid-2,2,4,4-d4 is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].
ACER2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
SARS-CoV-2 Mpro-IN-4 is a dual Inhibitor of Main Protease (M Pro) and Cathepsin L (CatL), with IC50s of 900 nM and 60 nM respectively. SARS-CoV-2 Mpro-IN-4 has antiviral activity against SARS-CoV2. SARS-CoV-2 Mpro-IN-4 blocks SARS-CoV2 replication in hACE2 expressing A549 cells with IC50 value of 8.2 nM .
SARS-CoV-2 Mpro-IN-5 is a dual Inhibitor of Main Protease (M Pro) and Cathepsin L (CatL), with IC50s of 1800 nM and 145 nM respectively. SARS-CoV-2 Mpro-IN-5 has antiviral activity against SARS-CoV2. SARS-CoV-2 Mpro-IN-5 blocks SARS-CoV2 replication in hACE2 expressing A549 cells with IC50 value of 14.7 nM .
COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.
Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1477 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 μM [2].
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the ACE2 PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .
DX600 is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity [2] .
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
DX600 TFA is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity [2] .
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment .
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19 .
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC50 of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC50 of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC50 of 52 µM [2].
Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity [2] .
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis . (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection [2].
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2(CK2). Anti-inflammatory and anticancer effects [2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
Garcinone B, a xanthone derivative, is a nature product that could be isolated from the pericarp of Mangosteen. Garcinone B is a potent ACE2 and Mpro inhibitor. Garcinone B can be used in research of COVID-19 .
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2(CK2). Anti-inflammatory and anticancer effects [2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 723 a.a., with molecular weight of 115-125 kDa.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of ACE2 Protein, Human (sf9, His) is 740 a.a., with molecular weight of ~85.1 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-His, C-Avi labeled tag. The total length of ACE2 Protein, Cynomolgus (HEK293, His-Avi) is 722 a.a., with molecular weight of 95-110 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 722 a.a., with molecular weight of 87-110 kDa.
ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Rhesus Macaque (HEK293, Fc) is 739 a.a., with molecular weight of ~110.7 kDa.
ACE2 Protein, a crucial carboxypeptidase in the renin-angiotensin system, regulates blood volume and vascular resistance, maintaining cardiovascular homeostasis. It converts angiotensin I to anti-hypertrophic angiotensin 1-9 and angiotensin II to vasodilatory angiotensin 1-7, countering vasoconstriction. ACE2 also regulates amino acid transport, interacting with SLC6A19, and modulates vasoactive peptides like neurotensin and kinetensin. Its multifaceted functions make ACE2 pivotal in cardiovascular and amino acid homeostasis. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293, with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag. The total length of ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is 740 a.a., with molecular weight of ~86.86 kDa.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (740a.a, HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Human (740a.a, HEK293, His) is 723 a.a., with molecular weight of ~85.1 kDa.
ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.
ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.
ACE2 Protein, Human (HEK293, His) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag. The total length of ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is 723 a.a., with molecular weight of 114.9 kDa.
Methylprednisolone-d3 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d4 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d7 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d2 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].
Ursodeoxycholic acid-2,2,4,4-d4 is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].
ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.
Inquiry Online
Your information is safe with us. * Required Fields.