Search Result
Results for "
Cys129
" in MedChemExpress (MCE) Product Catalog:
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-117430
-
-
-
- HY-P1789A
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P10388
-
|
|
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
-
- HY-P1789
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
-
- HY-P4860
-
|
|
Akt
|
Metabolic Disease
|
|
Adropin (34-76) (human, mouse, rat) regulates fuel selection preferences in skeletal muscle. Adropin increases insulin-induced Akt phosphorylation and cell-surface expression of GLUT4, in diet-induced obesity (DIO) mouse.
|
-
-
- HY-P5845
-
|
α-RgIA
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin RgIA (α-RgIA) is a specific α9α10 nAChR antagonist. α-Conotoxin RgIA can be obtained from Conus regius venom. α-Conotoxin RgIA can be used in the study of neurological diseases .
|
-
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
-
- HY-P0049
-
Argipressin
Maximum Cited Publications
8 Publications Verification
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
-
- HY-A0182
-
-
-
- HY-P0004
-
|
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
-
-
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
-
- HY-P1036
-
|
|
Complement System
|
Others
|
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
-
- HY-P1036A
-
|
|
Complement System
|
Others
|
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
-
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
-
- HY-P0049A
-
|
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
|
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
-
- HY-P1270
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors. α-Conotoxin Im-I is toxic and induces seizures in rodents. α-Conotoxin Im-I is a tool for studying neuronal nAChR .
|
-
-
- HY-W539944
-
|
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
|
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
-
- HY-P4605
-
-
-
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
-
- HY-P4994
-
-
-
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
-
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
-
- HY-P5907
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
-
- HY-P1632
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
-
- HY-P10079
-
-
-
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
-
- HY-P10235
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
-
-
- HY-P0202
-
-
-
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
-
- HY-P0204A
-
-
-
- HY-P0256A
-
|
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
-
- HY-P2538
-
-
-
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
-
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
-
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
-
- HY-P3433
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
-
- HY-P3512
-
|
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
|
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
-
- HY-102029
-
|
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
-
-
- HY-P3571
-
|
|
Endothelin Receptor
|
Cancer
|
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
![[Ala2] Endothelin-3, human](//file.medchemexpress.com/product_pic/hy-p3571.gif)
-
- HY-P3563
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
-
![[Lys4] Sarafotoxin S6c](//file.medchemexpress.com/product_pic/hy-p3563.gif)
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
-
-
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
-
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
-
-
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
-
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
-
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P5820
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
-
- HY-P5141A
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
μ-Conotoxin KIIIA TFA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2). μ-Conotoxin KIIIA TFA can be used for research of pain .
|
-
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P3071
-
|
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-P0188
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin MVIIC is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
-
- HY-P0188A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
-
- HY-P3064
-
|
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
-
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5864
-
|
|
Sodium Channel
|
Neurological Disease
|
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
-
- HY-P1408
-
|
|
Integrin
|
Cancer
|
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P5143
-
|
|
Calcium Channel
|
Inflammation/Immunology
|
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
-
- HY-P5902
-
-
- HY-P1408A
-
|
|
Integrin
|
Cancer
|
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
-
- HY-P1206
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
-
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-106302
-
|
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P0189
-
-
- HY-P0189A
-
-
- HY-P5825
-
-
- HY-P5828
-
-
- HY-P1955
-
|
AMG 416; KAI-4169
|
CaSR
|
Endocrinology
|
|
Etelcalcetide (AMG 416) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
-
- HY-P1955A
-
|
AMG 416 hydrochloride; KAI-4169 hydrochloride
|
CaSR
|
Endocrinology
|
|
Etelcalcetide hydrochloride (AMG 416 hydrochloride) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide hydrochloride is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P4916
-
|
|
Peptides
|
Others
|
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P10388
-
|
|
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
- HY-P10332
-
|
|
Peptides
|
Others
|
|
WL 47 dimer (ligand 1) is a caveolin-1 (CAV-1) ligand with high affinity, selectivity and oligomer dissociation activity. WL 47 dimer simultaneously occupies two binding sites of CAV-1, inducing the dissociation of oligomers. WL 47 dimer has 7500-fold improved affinity compared to its T20 parent ligand and an 80% decrease in sequence length. WL 47 dimer can be used to permit targeted study of CAV-1 function .
|
-
- HY-P5533
-
|
|
Peptides
|
Cancer
|
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
- HY-P1487
-
|
|
Peptides
|
Neurological Disease
|
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
-
- HY-P1789
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P1789A
-
|
|
MMP
|
Inflammation/Immunology
Cancer
|
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P2526
-
|
|
Peptides
|
Cancer
|
|
LyP-1 is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P2526A
-
|
|
Peptides
|
Cancer
|
|
LyP-1 TFA is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P4860
-
|
|
Akt
|
Metabolic Disease
|
|
Adropin (34-76) (human, mouse, rat) regulates fuel selection preferences in skeletal muscle. Adropin increases insulin-induced Akt phosphorylation and cell-surface expression of GLUT4, in diet-induced obesity (DIO) mouse.
|
-
- HY-P5322
-
|
|
Peptides
|
Others
|
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a biological active peptide. (This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It is cyclized through a disulfide bond. Thrombospondin is a matrix-bound glycoprotein involved in cancer metastasis, tumor adhesion, and angiogenesis. This peptide has been shown to competitively inhibit platelet aggregation and tumor metastasis.)
|
-
- HY-P5845
-
|
α-RgIA
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin RgIA (α-RgIA) is a specific α9α10 nAChR antagonist. α-Conotoxin RgIA can be obtained from Conus regius venom. α-Conotoxin RgIA can be used in the study of neurological diseases .
|
-
- HY-P5217
-
|
|
Peptides
|
Others
|
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
- HY-P3222
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P3222A
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin antiparallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
-
- HY-P0049
-
Argipressin
Maximum Cited Publications
8 Publications Verification
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-A0182
-
-
- HY-P0004
-
|
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
-
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P1036
-
|
|
Complement System
|
Others
|
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1463
-
|
Thyrocalcitonin eel
|
Peptides
|
Endocrinology
|
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
-
- HY-P1574
-
|
Vasotocin, Argiprestocin, Arginine vasotocin
|
Peptides
|
Neurological Disease
|
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
-
- HY-P1574A
-
-
- HY-P1463A
-
|
Thyrocalcitonin eel TFA
|
Peptides
|
Others
|
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
-
- HY-P1737
-
|
Con-S
|
Peptides
|
Cardiovascular Disease
|
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P1036A
-
|
|
Complement System
|
Others
|
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
- HY-P0049A
-
|
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
|
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
- HY-P1270
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors. α-Conotoxin Im-I is toxic and induces seizures in rodents. α-Conotoxin Im-I is a tool for studying neuronal nAChR .
|
-
- HY-P3953
-
|
|
Peptides
|
Metabolic Disease
|
|
Wy 41747 is a long-acting Somatostatin analogue. Wy 41747 can be used for the research of diabetes mellitus .
|
-
- HY-W539944
-
|
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
|
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
- HY-P4184
-
|
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4912
-
|
|
Peptides
|
Others
|
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4605
-
-
- HY-P4973
-
|
|
Peptides
|
Others
|
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P4994
-
-
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
- HY-P5166
-
|
|
Peptides
|
Others
|
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
-
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P4184A
-
|
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5907
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
- HY-P1632
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P5642
-
|
RC-101
|
Peptides
|
Infection
|
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
- HY-P10079
-
-
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
- HY-P10235
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Cyclic AC253 is an antagonist for amylin receptor, with IC50 of 0.3 μM. Cyclic AC253 exhibits neuroprotective efficacy against Aβ toxicity and abrogates Aβ-induced impairment of hippocampal long-term potentiation. Cyclic AC253 penetrate blood-brain barrier (BBB) .
|
- HY-P10237
-
|
|
Peptides
|
Others
|
|
Calcitonin chicken is a hormone, that regulates calcium metabolism. Calcitonin chicken suppresses the cell motility and bone resorption in neonatal rat osteoclasts .
|
- HY-P0202
-
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0207
-
|
Endothelin-2 (human, canine); Human endothelin-2
|
Peptides
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P0204
-
- HY-P0204A
-
- HY-P0256A
-
|
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0207A
-
|
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Peptides
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P2538
-
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
- HY-P3433
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-P3512
-
|
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
|
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
- HY-102029
-
|
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
- HY-P3571
-
|
|
Endothelin Receptor
|
Cancer
|
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P3563
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
- HY-17571F
-
|
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Peptides
|
Others
|
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
- HY-P10383
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P10383A
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P0083
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P3204
-
POT-4
1 Publications Verification
AL-78898A
|
Complement System
|
Metabolic Disease
|
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
- HY-P3682
-
|
|
Peptides
|
Neurological Disease
|
|
w-Conotoxin SVIB is a peptide toxin, it can be isolated from Conus venoms. w-Conotoxin SVIB inhibits twitch response with an IC50 value of 37 nM. w-Conotoxin SVIB induces respiratory distress and it can be lethal to mice at a high concentration .
|
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P5820
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
- HY-P5141A
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
μ-Conotoxin KIIIA TFA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2). μ-Conotoxin KIIIA TFA can be used for research of pain .
|
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P3071
-
|
Stichodactyla helianthus neurotoxin
|
Potassium Channel
|
Inflammation/Immunology
|
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-P0188
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin MVIIC is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
- HY-P0188A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
- HY-P3064
-
|
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5864
-
|
|
Sodium Channel
|
Neurological Disease
|
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
- HY-P1408
-
|
|
Integrin
|
Cancer
|
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P5143
-
|
|
Calcium Channel
|
Inflammation/Immunology
|
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
- HY-P5902
-
- HY-P1408A
-
|
|
Integrin
|
Cancer
|
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P5568
-
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
- HY-P2005
-
|
|
Peptides
|
Others
|
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
- HY-P1206
-
|
|
Somatostatin Receptor
|
Neurological Disease
|
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P3215
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3215A
-
|
|
Peptides
|
Endocrinology
|
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P0189
-
- HY-P0189A
-
- HY-P5825
-
- HY-P5828
-
- HY-P1955
-
|
AMG 416; KAI-4169
|
CaSR
|
Endocrinology
|
|
Etelcalcetide (AMG 416) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
- HY-P1955A
-
|
AMG 416 hydrochloride; KAI-4169 hydrochloride
|
CaSR
|
Endocrinology
|
|
Etelcalcetide hydrochloride (AMG 416 hydrochloride) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide hydrochloride is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent:
![[Ala2] Endothelin-3, human](http://file.medchemexpress.com/product_pic/hy-p3571.gif)
![[Lys4] Sarafotoxin S6c](http://file.medchemexpress.com/product_pic/hy-p3563.gif)
