1. Peptides
  2. Teduglutide TFA

Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA is associated with trophic effects on gut mucosa. Teduglutide TFA can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Teduglutide TFA Chemical Structure

Teduglutide TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Teduglutide TFA:

Other Forms of Teduglutide TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Teduglutide TFA

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA is associated with trophic effects on gut mucosa. Teduglutide TFA can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD)[1][2].

Clinical Trial
Molecular Weight

3752.13 (free acid)

Formula

C164H252N44O55S.xC2HF3O2

Sequence Shortening

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Teduglutide TFA
Cat. No.:
HY-P1624A
Quantity:
MCE Japan Authorized Agent: