1. Search Result
Search Result
Results for "

monocytes

" in MedChemExpress (MCE) Product Catalog:

101

Inhibitors & Agonists

1

Fluorescent Dye

4

Biochemical Assay Reagents

17

Peptides

1

Inhibitory Antibodies

8

Natural
Products

3

Recombinant Proteins

13

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-N2110

    Akt Inflammation/Immunology
    Phellopterin is a natural product isolated from Angelica dahurica. Phellopterin reduces TNF-alpha-induced VCAM-1 expression through regulation of the Akt and PKC pathway, which contributes to inhibit the adhesion of monocytes to endothelium .
    Phellopterin
  • HY-106228

    Fungal Bacterial Glutathione Peroxidase Infection
    HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .
    HLF1-11
  • HY-P99704

    OCS-02

    TNF Receptor Inflammation/Immunology
    Licaminlimab (OCS-02) is a single-chain anti-TNF alpha antibody fragment. TNF alpha is an inflammatory cytokine produced by macrophages and monocytes during inflammation .
    Licaminlimab
  • HY-14762

    Antibiotic Bacterial Infection
    Besifloxacin is a fluoroquinolone antimicrobial agent. Besifloxacin can inhibit cytokine production by monocytes. Besifloxacin has broad-spectrum antibacterial activity .
    Besifloxacin
  • HY-125445

    Others Inflammation/Immunology
    PCTR1 is a potent monocyte/macrophage agonist, regulating key anti-inflammatory and pro-resolving processes during bacterial infection. PCTR1 is a member of the protectin family of specialized pro-resolving mediators (SPMs) .
    PCTR1
  • HY-157939

    EBI2/GPR183 Inflammation/Immunology
    GPR183 antagonist-3 (compound 33) is an oral active GPR183 antagonist with the IC50 of 8.7 μM. GPR183 antagonist-3 displays strong in vitro antimigration and anti-inflammatory activity in monocytes, and improves the pathological symptoms of DSS-induced experimental colitis .
    GPR183 antagonist-3
  • HY-122767

    Muroctasin

    Interleukin Related Inflammation/Immunology
    Romurtide (Muroctasin), a synthetic muramyl dipeptide derivative, is a cytokines inducer. Romurtide can increase peripheral neutrophils and monocytes in vivo and enhance production of colony-stimulating factors (CSFs), IL-1 and IL-6 in vitro .
    Romurtide
  • HY-13568

    LRCL 3794

    COX Inflammation/Immunology
    Benoxaprofen (LRCL 3794) is a potent and long-acting anti-inflammatory and antipyretic compound. Benoxaprofen is a relatively weak inhibitor of cyclooxygenase in in vitro systems, inhibits lipoxygenase in other systems, and inhibits monocyte migration in some animal models of inflammation .
    Benoxaprofen
  • HY-14926

    (S)-(-)-Nadifloxacin; WCK 771

    Antibiotic Bacterial Infection
    Levonadifloxacin ((S)-(-)-Nadifloxacin; WCK 771) is a broad-spectrum anti-staphylococcal agent. Levonadifloxacin shows antibacterial activity against Methicillin (HY-121544)-susceptible Staphylococcus aureus (MSSA) and Methicillin-resistant S. aureus (MRSA) strains, with a reduction of which phagocytized in THP-1 monocytes .
    Levonadifloxacin
  • HY-129905

    LLOMe hydrochloride; Leu-Leu methyl ester hydrochloride; H-Leu-Leu-OMe hydrochloride

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrochloride, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrochloride also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrochloride
  • HY-129905A

    LLOMe hydrobromide; Leu-Leu methyl ester hydrobromide; H-Leu-Leu-OMe hydrobromide

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrobromide, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrobromide also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrobromide
  • HY-102065

    Prostaglandin Receptor Others
    SC-19220 is a competitive prostaglandinn E2 receptor antagonist. SC-19220 increases the bladder capacity and reduced the voiding efficiency of micturition (elicited by slow transvesical filling) of urethane-anesthetized rats. SC-19220 can restores the balance in bone marrow granulocyte and monocyte production after burn sepsis .
    SC-19220
  • HY-14648
    Dexamethasone
    Maximum Cited Publications
    127 Publications Verification

    Hexadecadrol; Prednisolone F

    Glucocorticoid Receptor SARS-CoV Autophagy Complement System Mitophagy Bacterial Antibiotic ADC Cytotoxin Infection Inflammation/Immunology Endocrinology Cancer
    Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist, apoptosis inducer, and common disease inducer in experimental animals, constructing models of muscle atrophy, hypertension, and depression. Dexamethasone can inhibit the production of inflammatory miRNA-155 exosomes in macrophages and significantly reduce the expression of inflammatory factors in neutrophils and monocytes. Dexamethasone also has potential for use in COVID-19 research .
    Dexamethasone
  • HY-14648A
    Dexamethasone acetate
    2 Publications Verification

    Dexamethasone 21-acetate; Hexadecadrol acetate

    Glucocorticoid Receptor Autophagy Mitophagy Bacterial SARS-CoV Antibiotic Complement System ADC Cytotoxin Inflammation/Immunology Endocrinology Cancer
    Dexamethasone acetate (Dexamethasone 21-acetate) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.
    Dexamethasone acetate
  • HY-13682
    Mifamurtide
    1 Publications Verification

    MTP-PE; L-MTP-PE; CGP 19835

    NOD-like Receptor (NLR) Inflammation/Immunology Cancer
    Mifamurtide (MTP-PE), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide has potential for use in rare disease and osteosarcoma research .
    Mifamurtide
  • HY-13682B
    Mifamurtide sodium
    1 Publications Verification

    MTP-PE sodium; L-MTP-PE sodium; CGP 19835 sodium

    NOD-like Receptor (NLR) Inflammation/Immunology Cancer
    Mifamurtide sodium (MTP-PE sodium), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide sodium is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide sodium has potential for use in rare disease and osteosarcoma research .
    Mifamurtide sodium
  • HY-14648S5

    Hexadecadrol-d3-1; Prednisolone F-d3-1

    Isotope-Labeled Compounds Cancer
    Dexamethasone-d3-1 (Hexadecadrol-d3-1; Prednisolone F-d3-1) is a deuterium labeled Dexamethasone (HY-14648). Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.
    Dexamethasone-d3-1
  • HY-13682C
    Mifamurtide TFA
    1 Publications Verification

    MTP-PE TFA; L-MTP-PE TFA; CGP 19835 TFA

    NOD-like Receptor (NLR) Inflammation/Immunology Cancer
    Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide TFA has potential for use in rare disease and osteosarcoma research .
    Mifamurtide TFA
  • HY-13682R

    NOD-like Receptor (NLR) Inflammation/Immunology Cancer
    Mifamurtide (Standard) is the analytical standard of Mifamurtide. This product is intended for research and analytical applications. Mifamurtide (MTP-PE), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide has potential for use in rare disease and osteosarcoma research .
    Mifamurtide (Standard)
  • HY-143686

    Biochemical Assay Reagents Cancer
    ImmTher is a liposome-encapsulated lipophilic disaccharide tripeptide derivative of muramyl dipeptide. ImmTher can up-regulate specific monocyte cytokine genes and activate monocyte-mediated tumoricidal activity .
    ImmTher
  • HY-109014

    CMX-157

    HIV HBV Nucleoside Antimetabolite/Analog Infection
    Tenofovir exalidex (CMX157) is a lipid conjugate of the acyclic nucleotide analog Tenofovir with activity against both wild-type and antiretroviral drug-resistant HIV strains, including multidrug nucleoside/nucleotide analog-resistant viruses. Tenofovir exalidex is active against all major subtypes of HIV-1 and HIV-2 in fresh human PBMCs and against all HIV-1 strains evaluated in monocyte-derived macrophages, with EC50s ranging between 0.2 and 7.2 nM. CMX157 is orally available and has no apparent toxicity. Tenofovir exalidex also shows antiviral activity against HBV .
    Tenofovir exalidex
  • HY-18763S

    Ibustrin-d5

    Isotope-Labeled Compounds COX Cardiovascular Disease
    Indobufen-d5 is deuterium labeled Indobufen. Indobufen is a platelet aggregation inhibitor. Indobufen is a reversible platelet cyclooxygenase (Cox) activity inhibitor. Indobufen suppresses thromboxane A2 (TxA2) synthesis. Indobufen down-regulates tissue factor (TF) in monocytes[1].
    Indobufen-d5
  • HY-P2311

    Endogenous Metabolite Antibiotic
    Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
    Defensin HNP-2 human
  • HY-160197

    NOD-like Receptor (NLR) Others
    Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
    Aluminum phosphate adjuvant
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Others
    Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
    Met-RANTES (human)
  • HY-P1117

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity .
    MMK1
  • HY-P1117A

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity .
    MMK1 TFA
  • HY-102040

    (Z)-Hispidol

    TNF Receptor Inflammation/Immunology
    Hispidol ((Z)-Hispidol) is a potential therapeutic for inflammatory bowel disease; inhibits TNF-α induced adhesion of monocytes to colon epithelial cells with an IC50 of 0.50 µM.
    Hispidol
  • HY-76383

    Others Metabolic Disease Inflammation/Immunology
    LR-90 is an advanced glycation end product (AGE) inhibitor, inhibits inflammatory responses in human monocytes . LR-90 is also used in the research of diabetic animal model .
    LR-90
  • HY-107352

    Fosinoprilat; Fosinoprilic acid; SQ 27519

    Angiotensin-converting Enzyme (ACE) Toll-like Receptor (TLR) NF-κB TNF Receptor Interleukin Related Cardiovascular Disease Inflammation/Immunology
    Fosfenopril (Fosinoprilat) is a potent angiotensin converting enzyme (ACE) inhibitor. Fosfenopril alleviates lipopolysaccharide (LPS)-induced inflammation by inhibiting TLR4/NF-κB signaling in monocytes .
    Fosfenopril
  • HY-N3646

    Others Others Neurological Disease Inflammation/Immunology Cancer
    Cudratricusxanthone A is isolated from Cudrania tricuspidata, and has anti-inflammatory, hepatoprotective, and anti-proliferative activities. Cudratricusxanthone A inhibits osteoclast differentiation and function in RAW 264.7 cells and mouse bone marrow monocytes .
    Cudratricusxanthone A
  • HY-110343

    TNF Receptor Inflammation/Immunology
    DBM 1285 dihydrochloride is an orally active TNF-α production inhibitor with anti-inflammatory effects. DBM 1285 dihydrochloride inhibits Lipopolysaccharide (LPS)-induced TNF-α secretion in various cells of macrophage/monocyte lineage .
    DBM 1285 dihydrochloride
  • HY-148045

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR9-IN-1 is a potent and selective TLR9 inhibitor with an IC50 value of 7 nM for human TLR9. TLR9-IN-1 can be used for researching diseases associated with undesirable immune response .
    TLR9-IN-1
  • HY-148274

    PROTACs IRAK Apoptosis Cancer
    KTX-582 is a potent IRAK4 degrader with DC50 values of 4 nM and 5 nM for IRAK4 and Ikaros, respectively. KTX-582 can induce apoptosis in MYD88 MT DLBCL, and is efficient to induce in vivo tumor regressions in lymphoma model .
    KTX-582
  • HY-B0253
    Piroxicam
    1 Publications Verification

    CP-16171

    COX Inflammation/Immunology Cancer
    Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam
  • HY-18763
    Indobufen
    1 Publications Verification

    Ibustrin

    COX Cardiovascular Disease
    Indobufen is a platelet aggregation inhibitor. Indobufen is a reversible platelet cyclooxygenase (Cox) activity inhibitor. Indobufen suppresses thromboxane A2 (TxA2) synthesis. Indobufen down-regulates tissue factor (TF) in monocytes .
    Indobufen
  • HY-156850

    HDAC Cancer
    ITF 3756 is a potent and selective HDAC6 inhibitor. ITF 3756 reduces in vitro the expression of PD-L1 on human monocytes and on CD8 T cells, and shows anti-tumor activity .
    ITF 3756
  • HY-N11906

    Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether

    Others Inflammation/Immunology
    Diayangambin (Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether) is a cell proliferation inhibitor with an IC50 value of 1.5 μM against human monocytes. Diayangambin also has immunosuppressive and anti-inflammatory effects .
    Diayangambin
  • HY-108661

    P2Y Receptor Inflammation/Immunology
    NF546 is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546
  • HY-108661A

    P2Y Receptor Inflammation/Immunology
    NF546 (hydrate) is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 (hydrate) stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546 hydrate
  • HY-15450A

    CCR Endocrinology
    INCB 3284 is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 can be used in the research of acute liver failure.
    INCB 3284
  • HY-145653

    Phospholipase Cardiovascular Disease Neurological Disease Inflammation/Immunology
    GSK2647544 is an orally available, selective inhibitor of Lp-PLA2. Lipoprotein-associated phospholipase (Lp-PLA2) is a calcium-independent phospholipase A2 with proinflammatory activities that is primarily secreted by monocyte-derived macrophages .
    GSK2647544
  • HY-B0253S

    CP-16171 d3

    COX Inflammation/Immunology Cancer
    Piroxicam-d3 is deuterium labeled Piroxicam. Piroxicam is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively [1].
    Piroxicam-d3
  • HY-15450

    CCR Endocrinology
    INCB 3284 dimesylate is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 dimesylate can be used in the research of acute liver failure.
    INCB 3284 dimesylate
  • HY-16384

    Antibiotic L 156602; PD 124966

    Complement System Inflammation/Immunology
    L-156602 is a C5a receptor antagonist. L-156602 inhibits inflammation, and the migration of monocytes and neutrophils to the infiltrating site in mouse inflammatory models. L-156602 suppresses the efferent phase of delayed-type hypersensitivity (DTH) .
    L-156602
  • HY-14230

    CCR HIV Infection
    INCB9471 is a potent, selective and orally active CCR5 antagonist. INCB9471 shows anti-HIV-1 activity .
    INCB9471
  • HY-106409
    Tefinostat
    1 Publications Verification

    CHR-2845

    HDAC Apoptosis Cancer
    Tefinostat (CHR-2845) is a monocyte/macrophage targeted histone deacetylase (HDAC) inhibitor. Tefinostat can be cleaved into active acid CHR-2847 by the intracellular esterase human carboxylesterase-1 (hCE-1). Tefinostat can be used for the research of leukaemias .
    Tefinostat
  • HY-160197G

    NOD-like Receptor (NLR) Infection Inflammation/Immunology
    Aluminum phosphate adjuvant GMP is a Aluminum phosphate adjuvant produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
    Aluminum phosphate adjuvant (GMP)
  • HY-106282

    HIV Infection
    BIT-225 is an inhibitor for Vpu protein through block of Vpu ion channel, and thus inhibits the release of HIV-1, especially in monocyte-derived macrophages (EC50 is 2.25 μM), without significant cytotoxicity (TC50 is 284 μM) .
    BIT-225
  • HY-B0253S1

    CP-16171-d4

    Isotope-Labeled Compounds COX Inflammation/Immunology Cancer
    Piroxicam-d4 is the deuterium labeled Piroxicam. Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam-d4

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: