1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CD367/CLEC4A
  6. CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)

CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

The CD367/CLEC4A protein potentially plays a role in regulating immune reactivity and may have implications in modulating the differentiation and maturation of dendritic cells (DC). It is a C-type lectin receptor that can bind to carbohydrates such as mannose and fucose, as well as weakly interact with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. CD367/CLEC4A is involved in inhibiting B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Upon antigen stimulation, it undergoes clathrin-dependent endocytosis, delivering its antigenic cargo into the antigen presentation pathway and promoting cross-priming of CD8(+) T cells. This cross-presentation and cross-priming process can be enhanced by TLR7 and TLR8 agonists, resulting in increased expansion of CD8(+) T cells and high production of IFNG and TNF, while reducing levels of IL4, IL5, and IL13. In plasmacytoid dendritic cells, CD367/CLEC4A inhibits TLR9-mediated production of IFNA and TNF. Furthermore, its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) may contribute to the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

Q9QZ15 (Q70-L238)

Gene ID
Molecular Construction
N-term
10*His-SUMO
CLEC4A (Q70-L238)
Accession # Q9QZ15
C-term
Protein Length

Extracellular Domain

Synonyms
Clec4a; Clec4a2; Clecsf6; DcirC-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; CD antigen CD367
AA Sequence

QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Predicted Molecular Mass
39.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

CD367/CLEC4A Protein, Mouse (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD367/CLEC4A Protein, Mouse (Myc, His-SUMO)
Cat. No.:
HY-P71636
수량:
MCE Japan Authorized Agent: