1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Dectin-1
  6. Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution)

Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution)

Cat. No.: HY-P75296
Instrucciones de manejo Technical Support

Dectin-1/CLEC7A protein has (1->3)-β-D-glucan binding and pattern recognition receptor activity, participates in immune responses and recognizes specific structures. It regulates cytokine production and responds to fungal pathogens while being active on the cell surface. Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Dectin-1/CLEC7A protein has (1->3)-β-D-glucan binding and pattern recognition receptor activity, participates in immune responses and recognizes specific structures. It regulates cytokine production and responds to fungal pathogens while being active on the cell surface. Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-His labeled tag.

Background

The Dectin-1/CLEC7A protein is predicted to possess (1->3)-beta-D-glucan binding activity and pattern recognition receptor activity, making it capable of recognizing specific structures and participating in immune responses. It is also predicted to play a role in various processes, such as phagocytosis and recognition, as well as positively regulating the production of cytokines involved in inflammatory responses and responding to fungal pathogens. Functionally, it is known to be active on the cell surface. The protein is expressed in multiple tissues, including the brain, gut, limb, musculature, and ventral grey horn. In humans, mutations in the orthologous gene CLEC7A have been implicated in aspergillosis and chronic mucocutaneous candidiasis, suggesting its importance in immune defense against these conditions (Alliance of Genome Resources.April 2022). Moreover, the Dectin-1/CLEC7A protein shows broad expression across various tissues, including the lung (RPKM 2.7), bladder (RPKM 1.9), and 16 other tissues.

Species

Mouse

Source

HEK293

Tag

N-His

Accession

NP_064392.2 (F69-L244)

Gene ID
Molecular Construction
N-term
His
CLEC7A (F69-L244)
Accession # NP_064392.2
C-term
Protein Length

Partial

Synonyms
C-type lectin domain family 7 member A; Clecsf12; CD369; Clec7a
AA Sequence

FWRHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL

Predicted Molecular Mass
22.5 kDa
Peso molecular

Approximately 30-37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación

Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution)
Cat. No.:
HY-P75296
Cantidad:
MCE Japan Authorized Agent: