1. Recombinant Proteins
  2. Others
  3. GNGT1 Protein, Human (His)

GNGT1 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, functioning as a modulator or transducer. Its beta and gamma chains facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—collaboratively regulate and transduce signals across cell membranes. GNGT1 Protein, Human (His) is the recombinant human-derived GNGT1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GNGT1 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, functioning as a modulator or transducer. Its beta and gamma chains facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—collaboratively regulate and transduce signals across cell membranes. GNGT1 Protein, Human (His) is the recombinant human-derived GNGT1 protein, expressed by E. coli , with N-His labeled tag.

Background

GNGT1, a member of the guanine nucleotide-binding protein (G protein) family, serves as a crucial component in diverse transmembrane signaling systems, acting as a modulator or transducer. The beta and gamma chains of GNGT1 play essential roles in facilitating GTPase activity, enabling the exchange of GDP for GTP, and mediating interactions between G proteins and their effectors. The fundamental structure of G proteins consists of three units—alpha, beta, and gamma—working collaboratively to regulate and transduce signals across cell membranes.

Species

Human

Source

E. coli

Tag

N-His

Accession

P63211 (P2-C71)

Gene ID
Molecular Construction
N-term
His
GNGT1 (P2-C71)
Accession # P63211
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Guanine nucleotide-binding protein G(T) subunit gamma-T1; Transducin gamma chain
AA Sequence

PVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGC

Predicted Molecular Mass
9.9 kDa
Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

GNGT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GNGT1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GNGT1 Protein, Human (His)
Cat. No.:
HY-P76369
Quantity:
MCE Japan Authorized Agent: