1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. LD78-beta/CCL3L1 Protein, Human (HEK293 His)

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LD78-beta/CCL3L1 Protein, Human (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α.

Background

Among the reported genes with copy number variation (CNV), C Chemokine Ligand 3 Like 1 (CCL3L1) has been identified as one of the prominent genes with CNV in the current research field. CCL3L1 is clustered on chromosome 17q12. This gene showed involvement in segmental duplication which was enriched with the immune response gene. CCL3L1 encodes for LD78β, the isoforms of macrophage inflammatory protein 1α (MIP-1α) which only differs by three amino acids of the CCL3 mature protein (LD78α). The truncated-2 form of LD78β produced by CCL3L1 leads to high binding affinity to the CC chemokine receptor (CCR) 1 and 5[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P16619 (A24-A93)

Gene ID

414062  [NCBI]/ 6349  [NCBI]

Molecular Construction
N-term
CCL3L1 (A24-A93)
Accession # P16619
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCCL3L1, His; C-C Motif Chemokine 3-Like 1; Small-Inducible Cytokine A3-Like 1; Tonsillar Lymphocyte LD78 Beta Protein; CCL3L1; D17S1718; G0S19-2; SCYA3L1; CCL3L3
AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Predicted Molecular Mass
8.8 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

LD78-beta/CCL3L1 Protein, Human (HEK293 His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LD78-beta/CCL3L1 Protein, Human (HEK293 His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LD78-beta/CCL3L1 Protein, Human (HEK293 His)
Cat. No.:
HY-P7769
Quantity:
MCE Japan Authorized Agent: