1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. IL-25/IL-17E Protein, Mouse (HEK293, N-His)

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

Background

and is also produced by various immune cells such as CD8+ T cells, mast cells, macrophages, dendritic cells (DCs), eosinophils, basophils, group 2 innate lymphoid cells (ILC2s), epithelial and endothelial cells[1][2][3][4][5][6]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25 induces the expression of IL-4, IL-5, IL-13, TGF-β, and G-CSF[8][9]. IL-25 can stimulate cell proliferation, inhibition of apoptosis, production of inflammatory cytokines and chemokines, modulation of cell-cell adhesion, and cell motility in nonimmune cells[10][11][12][13]. IL-25 activates NF-κB, MAPKs and JAK/STATs signaling pathways[1][14]. The sequence homology of IL-25 between human and mouse, mouse and rat is 78.88% and 91.12% respectively.

Biological Activity

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 0.854-0.8788 ng/mL, corresponding to a specific activity is 1.138×106-1.171×106 U/mg.

  • Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED50 for this effect is 0.854 ng/mL, Corresponding to a specific activity is 1.171×106 U/mg.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q8VHH8 (V17-A169)

Gene ID

140806

Molecular Construction
N-term
His
IL-17E (V17-A169)
Accession # Q8VHH8
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Predicted Molecular Mass
17.5 kDa
Molecular Weight

Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-25/IL-17E Protein, Mouse (HEK293, N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-25/IL-17E Protein, Mouse (HEK293, N-His)
Cat. No.:
HY-P73198A
Quantity:
MCE Japan Authorized Agent: