2. Recombinant Proteins
  3. Enzymes & Regulators Ubiquitin Related Proteins
  4. Transferases (EC 2) Ubiquitin Enzymes
  5. E2 Enzymes
  6. Autophagy-Related Protein 10 (ATG10)
  7. ATG10 Protein, Human (GST)

ATG10 Protein, Human (GST)

Cat. No.: HY-P701246
Handling Instructions

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ATG10 Protein, Human (GST) is a recombinant human Autophagy Related 10 Homolog (ATG10) expressed in E. coli with a GST tag. ATG10 is an E2 ubiquitin-conjugating-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation[1].
Background

Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Autophagy-related 10 gene (ATG10), which encodes an E2-like enzyme, interacts with ATG7 to receive an ubiquitin-like protein ATG12, recognizes both ATG12 and ATG5 directly and catalyzes their conjugation reaction. ATG10 plays an important role in the invasion and proliferation of cancer cells, and bacterial infections[1].
Species

Human
Source

E. coli
Accession

Q9H0Y0 (M1-P220)
Gene ID

83734
Synonyms
Ubiquitin-Like-Conjugating Enzyme ATG10; Autophagy-Related Protein 10; APG10-Like; ATG10
AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Molecular Weight

52.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ATG10 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATG10 Protein, Human (GST)
Cat. No.:
HY-P701246
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.