Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc)

Betacellulin/BTC Protein, a member of the epidermal growth factor (EGF) family, is known to play an important role in regulating growth and differentiation of pancreatic beta cells. And it is a growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. In addition, BTC exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Betacellulin/BTC Protein, Cynomolgus (HEK293, Fc) is 111 a.a., with molecular weight of 45-55 kDa.

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, is known to play an important role in regulating growth and differentiation of pancreatic beta cells. BTC functions as a ligand for the epidermal growth factor receptor (EGFR) and is expressed in a variety of cell types and tissues. And it is a growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. BTC exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. BTC exerts proliferative activity on beta cells through the activation of ErbB-1 and ErbB-2 receptors, which may increase IRS-2 expression, contributing to the regeneration of beta cells^[1].

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 1.39 ng/mL, corresponding to a specific activity is 7.19×10⁵ units/mg.

Cynomolgus

HEK293

C-hFc

XP_001101880.3 (M1-Y111)

702178  [NCBI]

DGNSTRSPETNGLLCGDPDENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVTEQTPSCVCDEGYIGARCERVDLFY

Approximately 45-55 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.