1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-3B/GDF10
  6. BMP-3B/GDF10 Protein, Human (His)

BMP-3B/GDF10 Protein, Human (His)

Cat. No.: HY-P7332
COA Handling Instructions

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $45 In-stock
10 μg $126 In-stock
50 μg $353 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE BMP-3B/GDF10 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

Background

Bone Morphogenetic Protein 3 (BMP-3) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-3 is a major component of osteogenin, which has osteogenic activity[1]. BMP-3 is widely found in different animals, while the sequence in human is lowly similar to Rat (81.94%), and mouse (80.86%).
BMP-3 particularly serves as a reliable biomarker for screening colorectal cancer (CRC) because BMP-3 is hypermethylated and its protein expression is significantly reduced in cancer cell lines[2].
BMP-3 also plays a suppressor role in carcinogenesis, suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways[2].
BMP-3 could exert two-way regulatory effects on activin signaling in distinct cell types. BMP-3 stimulates proliferation of human mesenchymal stem cells which could be blocked by TGF-β/activin receptor kinase inhibitors[3].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[5].

In Vitro

"BMP-3 (1, 10, 50, and 10 ng/mL; 7, 14, and 21 d) alone and in combination with 10 ng/mL TGF-β promotes differentiation of human mesenchymal stem cells to a nucleus poposus phenotype[6].
BMP-3 (1, 2.5, and 10 ng/mL; 3 d) inhibits human bone marrow stromal cell (HBMSC) growth in a dose-dependent manner[7].
"

Species

Human

Source

E. coli

Tag

N-10*His

Accession

P55107 (Q369-R478)

Gene ID
Molecular Construction
N-term
10*His
BMP-3B (Q369-R478)
Accession # P55107
C-term
Synonyms
rHuBMP-3B; BIP; BMP-3B; GDF-10
AA Sequence

MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Molecular Weight

Approximately 16 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BMP-3B/GDF10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-3B/GDF10 Protein, Human (His)
Cat. No.:
HY-P7332
Quantity:
MCE Japan Authorized Agent: