CCR1 Protein, Mouse (Cell-Free, His)

CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

CCR1, a receptor belonging to the C-C type chemokine family, serves as a binding site for chemokines such as MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1. Upon ligand binding, CCR1 initiates signal transduction processes that lead to an elevation in intracellular calcium ion levels. This receptor plays a pivotal role in modulating stem cell proliferation, contributing to the regulation of cellular processes critical for tissue homeostasis and immune responses. Additionally, CCR1 interacts with CREB3, potentially participating in the intricate network of signaling pathways that govern cellular functions.

Mouse

E. coli Cell-free

N-10*His

P51675 (M1-F355)

12768

MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

43.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.