CD14 Protein, Rat (HEK293, His)

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Rat (HEK293, His) is 324 a.a., with molecular weight of 45-57 kDa.

CD14 Protein functions as a coreceptor for bacterial lipopolysaccharide (LPS), forming a multi-protein complex with LY96 and TLR4. Collaborating with LBP, it binds monomeric LPS and delivers it to the LY96/TLR4 complex, initiating the innate immune response. CD14's involvement extends to TLR2:TLR6 and TLR2:TLR1 heterodimers, responding to diacylated and triacylated lipopeptides, respectively. Through interactions with MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, leading to cytokine secretion and inflammation. Additionally, it participates in LDL(-)-induced cytokine release and interacts with LPAR1, MYO18A, and FSTL1, highlighting its diverse roles in immune and signaling pathways.

Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED₅₀ for this effect is 0.488 μg/mL, corresponding to a specific activity is 2049.180 U/mg.

Rat

HEK293

C-6*His

Q63691 (S18-Y341)

60350  [NCBI]

SPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAY

Approximately 45-57 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.