CD2 Protein, Rat (HEK293, Fc)

CD2 Protein, a cell surface glycoprotein, mediates T-cell activation and adhesion by binding to its ligand, CD58. It facilitates immune responses and intercellular communication. CD2 Protein is a promising target for immunotherapy and may lead to innovative treatments for immune-related disorders. CD2 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD2 Protein, Rat (HEK293, Fc) is 202 a.a., with molecular weight of 57-75 kDa.

CD2 protein plays a crucial role in facilitating adhesion between T-cells and various cell types through its interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. It is also involved in triggering T-cells and transmitting signals via its cytoplasmic domain. Additionally, CD2 interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, suggesting their potential involvement in related cellular processes. Notably, the interaction between CD2 and FCGR3A can modulate NK cell activation and cytotoxicity.

Measured by its binding ability in a functional ELISA. Immobilized Rat CD2, at 2μg/mL (100μL/well) can bind Anti-CD2 antibody. The ED₅₀ for this effect is 1.486 μg/mL.

Rat

HEK293

C-hFc

Q5I0M6 (R23-P202)

497761  [NCBI]

RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLP

Approximately 57-75 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.