CD93/C1qR1 Protein, Human (HEK293, His)

CD93/C1qR1 Protein, Human (HEK293, His) is a recombinant human CD93 produced in HEK293 cells, with His tag. CD93 is a type 1 transmembrane glycoprotein^[1].

CD93 is a highly glycosylated transmembrane protein expressed on monocytes, neutrophils, endothelial cells, and stem cells. CD93 consists of a C‐type lectin‐like domain (CTLD), five epidermal growth factor‐like domains, a mucin domain, a single transmembrane domain and an intracellular domain. CD93 is upregulated in tumor vessels in many cancers, including high-grade glioma^[1].

Measured by its ability to induce TNF-alpha secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 8.783 μg/mL, corresponding to a specific activity is 113.8563 U/mg.

• 
  Measured by its ability to induce TNF-alpha secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 8.783 μg/mL, corresponding to a specific activity is 113.8563 U/mg.

Human

HEK293

C-6*His

Q9NPY3 (A24-K580)

22918  [NCBI]

ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKHHHHHH

Approximately 82.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Brice Nativel, et al. CD93 is a cell surface lectin receptor involved in the control of the inflammatory response stimulated by exogenous DNA. Immunology. 2019 Oct;158(2):85-93.  [Content Brief]