EPS15 Protein, Human (His)

EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR). EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EPS15 Protein, Human (His) is 142 a.a., with molecular weight of 20.9 kDa.

EPS15, a multifaceted protein, intricately regulates cell growth and plays a pivotal role in the control of mitogenic signals and cell proliferation. It is particularly involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) family, with a notable impact on EGFR internalization. Functioning as a clathrin adapter, EPS15 is indispensable for the assembly of clathrin-coated pits (CCPs) and contributes to CCPs' maturation, including processes like invagination or budding. Its involvement extends to endocytosis of key molecules such as integrin beta-1 (ITGB1) and transferrin receptor (TFR), with the internalization of ITGB1 relying on its association with DAB2. EPS15 engages in a complex network of protein interactions, including SGIP1, HGS, STAM, STAM2, AP2A2, STON2, CRK, SH3BP4/TTP, ERBB2, FCHO1, FCHO2, DAB2, CORO7, UBQLN1, UBQLN2, REPS2, and EPN1, underscoring its versatility and significance in various cellular processes.

Human

E. coli

N-6*His

P42566 (C657-D798)

2060  [NCBI]

CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

20.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.