FCAR/CD89 Protein, Human (HEK293, His)

The FCAR/CD89 protein is crucial and can specifically bind to the Fc region of immunoglobulin α to promote the production of cytokines. FCAR/CD89 binds to the Fc epsilon RI gamma 2 receptor, induces gamma 2 tyrosine phosphorylation, and is complexly involved in signaling pathways and immune responses. FCAR/CD89 Protein, Human (HEK293, His) is the recombinant human-derived FCAR/CD89 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FCAR/CD89 Protein, Human (HEK293, His) is 206 a.a., with molecular weight of ~40 kDa.

The FCAR/CD89 protein plays a pivotal role as it specifically binds to the Fc region of immunoglobulins alpha, facilitating various functions such as cytokine production. In its association with the Fc epsilon RI gamma 2 receptor, FCAR/CD89 induces tyrosine phosphorylation of gamma 2, highlighting its involvement in intricate signaling pathways and immune responses. The interaction between FCAR/CD89 and immunoglobulins alpha underscores its significance in modulating immune processes and contributing to the regulation of cytokine production, emphasizing its multifaceted role in the immune system.

Human

HEK293

C-6*His

P24071 (Q22-N227)

2204  [NCBI]

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

Approximately 40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.