FSH beta Protein, Human (HEK293, His)

The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FSH beta Protein, Human (HEK293, His) is 111 a.a., with molecular weight of ~21.0 kDa.

FSH beta Protein, in conjunction with the alpha chain CGA, forms follitropin, the follicle-stimulating hormone, conferring its biological specificity to the hormone heterodimer. This protein binds to FSHR, a G protein-coupled receptor on target cells, initiating downstream signaling pathways. Follitropin plays a crucial role in follicle development and spermatogenesis in reproductive organs. Structured as a heterodimer, the active follitropin consists of an alpha chain/CGA shared with other hormones and a distinctive beta chain/FSHB. Through its interaction with FSHR, FSH beta Protein contributes to the regulation of reproductive processes, highlighting its significance in the intricate orchestration of fertility and reproductive health.

Human

HEK293

C-6*His

P01225 (N19-E129)

2488  [NCBI]

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Approximately 21.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.