G6B Protein, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag. The total length of G6B Protein, Human (HEK293, His) is 125 a.a., with molecular weight of ~18-23 kDa.

G6B, an inhibitory receptor, plays a crucial role in regulating hematopoietic lineage differentiation, megakaryocyte function, and platelet production. This regulatory function extends to inhibiting platelet aggregation and activation induced by various agonists like ADP and collagen-related peptide. The inhibition is mediated through the receptor's impact on CLEC1B and GP6:FcRgamma signaling, involving two immunoreceptor tyrosine-based inhibitor motifs (ITIMs). Notably, G6B operates in a calcium-independent manner. Isoform B, containing both a transmembrane region and the mentioned ITIMs, serves as the inhibitory counterpart, while isoform A is considered the activating counterpart of isoform B. This dual-isoform system reflects the nuanced regulatory mechanisms underlying hematopoiesis and platelet function.

Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED₅₀ for this effect is 2.344 μg/mL, corresponding to a specific activity is 4.266×10^2 U/mg.

Human

HEK293

C-6*His

O95866/NP_612116.1 (N18-Q142)

80739  [NCBI]

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Approximately 18-23 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.