GALNT10 Protein, Human (HEK293, His)

GALNT10 protein assumes a crucial role in the initiation of O-linked oligosaccharide biosynthesis, facilitating the transfer of an N-acetyl-D-galactosamine residue to specific serine or threonine residues on protein receptors. With its catalytic activity, GALNT10 demonstrates specificity towards substrates such as Muc5Ac and EA2 peptides, contributing to the intricate process of protein glycosylation and subsequent cellular functions. GALNT10 Protein, Human (HEK293, His) is the recombinant human-derived GALNT10 protein, expressed by HEK293 , with N-His labeled tag. The total length of GALNT10 Protein, Human (HEK293, His) is 565 a.a., with molecular weight of 70-75 KDa.

GALNT10, a member of the GALNT (N-acetylgalactosaminyltransferase) family, serves a pivotal role in the initiation of O-linked oligosaccharide biosynthesis. This enzyme catalyzes the transfer of an N-acetyl-D-galactosamine (GalNAc) residue to a serine or threonine residue on the protein receptor, marking the initial step in the glycosylation of proteins. GALNT10 exhibits its glycosyltransferase activity towards specific substrates such as Muc5Ac and EA2 peptide. Through this process, GALNT10 contributes to the diversification and modification of proteins by adding sugar moieties, thereby impacting various cellular functions and processes. The enzyme's specificity for certain substrates underscores its role in regulating glycosylation patterns in biological systems.

Measured by its ability to transfer GalNAc from UDP-GalNAc to peptide MUC5AC-3/13 that incubate at 37°C for 20 min. The specific activity is 688.65 pmol/min/μg.

Human

HEK293

N-10*His

Q86SR1-1/NP_938080.1 (T39-N603)

55568  [NCBI]

TPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN

Approximately 70-75 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.