Growth Hormone R/GHR Protein, Human (HEK293, hFc)

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (HEK293, hFc) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Growth Hormone R/GHR Protein, Human (HEK293, hFc) is 238 a.a., with molecular weight of ~66 kDa.

Growth Hormone R (GHR) functions as the receptor for pituitary gland growth hormone, playing a pivotal role in the regulation of postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, facilitating the intracellular signaling cascade. Additionally, the soluble form of the receptor, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the bloodstream. GHBP may also exert modulatory or inhibitory effects on growth hormone signaling, contributing to the intricate regulation of growth processes.

Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/mL can bind human GHR and the EC₅₀ of human GHR protein is 7.006-11.72 ng/mL.

Human

HEK293

C-hFc

P10912 (A27-Y264)

2690  [NCBI]

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Approximately 66 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.