GSTP1 Protein, Rat (His)

GSTP1 protein conjugates reduced glutathione to hydrophobic electrophiles, forms glutathione conjugates of PGA2 and PGJ2, and contributes to hepoxilin production. It also regulates CDK5 activity by facilitating p25/p35 translocation, preventing neurodegeneration. GSTP1 Protein, Rat (His) is the recombinant rat-derived GSTP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GSTP1 Protein, Rat (His) is 209 a.a., with molecular weight of ~24 kDa.

GSTP1 protein is responsible for conjugating reduced glutathione to various hydrophobic electrophiles, both exogenous and endogenous. It plays a role in forming glutathione conjugates of prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as well as contributing to the production of unique hepoxilin regioisomers. Additionally, GSTP1 helps regulate CDK5 activity by facilitating the translocation of p25/p35, thereby preventing neurodegeneration.

Measured by the conjugation of reduced glutathione to 1-bromo-2,4-dinitrobenzene. The specific activity is 13117.28 pmol/min/μg, as measured under the described conditions.

Rat

E. coli

N-6*His

P04906 (P2-Q210)

24426  [NCBI]

PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0. Normally 5% trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.