HIST3H2A Protein, Human

The HIST3H2A protein is a core component of nucleosomes that compact DNA into chromatin. HIST3H2A Protein, Human is the recombinant human-derived HIST3H2A protein, expressed by E. coli , with tag free. The total length of HIST3H2A Protein, Human is 129 a.a., with molecular weight of 15-20 KDa.

HIST3H2A, as a core component of the nucleosome, participates in the essential process of wrapping and compacting DNA into chromatin, thereby limiting DNA accessibility to cellular machineries that rely on DNA as a template. This histone protein, like others, holds a pivotal position in key cellular functions such as transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The intricate control of DNA accessibility involves a sophisticated system of post-translational modifications known as the histone code, along with dynamic nucleosome remodeling. The nucleosome itself is a histone octamer comprising two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, underscoring its crucial role in organizing chromatin structure and facilitating essential genomic processes.

Human

E. coli

Tag Free

Q7L7L0 (S2-K130)

92815  [NCBI]

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

15-20 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.