HLA-DMA Protein, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag. The total length of HLA-DMA Protein, Human (His) is 207 a.a., with molecular weight of ~27.4 kDa.

The HLA-DMA Protein is an essential member of the MHC class II family, playing a crucial role in antigen presentation and immune response regulation. As part of this family, HLA-DMA is involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. Recognized for its significance in the immune system, the HLA-DMA protein contributes to the activation of CD4+ T helper cells by presenting antigens derived from extracellular pathogens. Through its association with the MHC class II family, HLA-DMA underscores its integral role in facilitating adaptive immune responses and enhancing our understanding of immune system dynamics in health and disease.

Human

E. coli

N-His

Q6ICR9 (27V-233C)

3108  [NCBI]

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Approximately 27.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.