IFN-gamma Protein, Mouse (155a.a, HEK293)

IFN-gamma protein, a type II interferon, is a soluble cytokine secreted by cells in the immune systems, acting as a homodimer to bind the interferon gamma receptor and trigger a cellular response against infections. Mice deficient in IFN-gamma display heightened susceptibility to various infections and an increased risk of autoimmune diseases. In the reference dataset, IFN-gamma exhibits low expression levels. IFN-gamma Protein, Mouse (155a.a, HEK293) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of IFN-gamma Protein, Mouse (155a.a, HEK293) is 133 a.a., with molecular weight of ~17.6 & 21.7 kDa, respectively.

IFN-gamma protein, a member of the type II interferon class, is a soluble cytokine secreted by cells of both the innate and adaptive immune systems. In its active form, it exists as a homodimer that binds to the interferon gamma receptor, initiating a cellular response against viral and microbial infections. Mice deficient in this gene exhibit heightened susceptibility to viral, bacterial, and parasitic infections, as well as an increased risk of several autoimmune diseases. In the reference dataset, IFN-gamma demonstrates low expression levels.

Mouse

HEK293

Tag Free

NP_032363.1 (H23-C155)

15978  [NCBI]

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Approximately 17.6&21.7 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.