IL-7 Protein, Human

IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

Recombinant Human Interleukin-7 (r-hIL-7) has a central role in T-cell development and survival and enhances immune recovery in murine models of allo-hematopoietic stem cell transplantation (allo-HSCT). Recombinant Human Interleukin-7 induces a doubling in CD4⁺ and CD8⁺ T cells. The main effect of IL-7 is an expansion of effector memory T cells. r-hIL-7 can enhance immune recovery after a T cell–depleted allo-HSCT without causing significant GVHD or other serious toxicity^[1].

1.The ED₅₀ is <0.5 ng/mL as measured by murine 2E8 cells, corresponding to a specific activity of >2.0 × 10⁶ units/mg.
2.Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED₅₀ for this effect is 0.02-0.08 ng/mL.

Human

E. coli

Tag Free

P13232 (D26-H177)

3574  [NCBI]

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

17-20 kD

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Perales MA, et al. Recombinant human interleukin-7 (CYT107) promotes T-cell recovery after allogeneic stem cell transplantation. Blood. 2012 Dec 6;120(24):4882-91.  [Content Brief]