Kallikrein-8 Protein, Mouse (P.pastoris, His)

Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Kallikrein-8 Protein, Mouse (P.pastoris, His) is 228 a.a., with molecular weight (glycosylation form) of ~32 kDa.

Kallikrein-8, a serine protease, exhibits the capability to degrade various proteins, including casein, fibrinogen, kininogen, fibronectin, and collagen type IV. Moreover, it cleaves L1CAM in response to heightened neural activity, thereby inducing neurite outgrowth and fasciculation in cultured hippocampal neurons. This protease plays a pivotal role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus, and is essential for memory acquisition and synaptic plasticity. Additionally, Kallikrein-8 is involved in skin desquamation and keratinocyte proliferation, contributing to these processes. Furthermore, it plays a significant role in the secondary phase of pathogenesis following spinal cord injury, underscoring its diverse functions in neural and cutaneous processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

P. pastoris

N-6*His

Q61955 (I33-D260)

259277  [NCBI]

ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Approximately 32 kDa. The reducing (R) protein migrates as 32 kDa in SDS-PAGE due to glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.