lacY Protein, E.coli strain K12 (Cell-Free, His)

lacY protein facilitates the symport transport of beta-galactosides into the cell, co-importing a proton. Its versatile substrate range includes lactose, melibiose, lactulose, and TMG, excluding sucrose or fructose. lacY's substrate specificity centers on the galactopyranosyl moiety. lacY Protein, E.coli strain K12 (Cell-Free, His) is the recombinant E. coli-derived lacY protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of lacY Protein, E.coli strain K12 (Cell-Free, His) is 250 a.a., with molecular weight of 34.4 kDa.

The lacY protein is responsible for facilitating the transport of beta-galactosides into the cell, operating as a symport system that concurrently imports a proton. This protein demonstrates the ability to transport various compounds, including lactose, melibiose, the synthetic disaccharide lactulose, or the analog methyl-1-thio-beta,D-galactopyranoside (TMG). However, it does not transport sucrose or fructose. Notably, lacY's substrate specificity is directed towards the galactopyranosyl moiety of the substrate.

E.coli

E. coli Cell-free

N-10*His

P02920 (M1-F250)

75202506

MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFTINNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFDQQFANFFTSF

34.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.