1. Recombinant Proteins
  2. Others
  3. MD-2/LY96 Protein, Mouse (HEK293, Fc)

MD-2/LY96 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P77081
COA Handling Instructions

MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact. This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities. MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293, with C-hFc labeled tag. The total length of MD-2/LY96 Protein, Mouse (HEK293, Fc) is 142 a.a., with molecular weight of ~47 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $95 In-stock
10 μg $160 In-stock
50 μg $450 In-stock
100 μg $770 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MD-2/LY96 Protein, acting as a monomer, robustly and specifically binds to interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4) with which it does not interact. This selective binding highlights MD-2/LY96's pivotal role in mediating cellular responses to IL13, underscoring its significance in IL13-related biological activities. MD-2/LY96 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived MD-2/LY96 protein, expressed by HEK293, with C-hFc labeled tag. The total length of MD-2/LY96 Protein, Mouse (HEK293, Fc) is 142 a.a., with molecular weight of ~47 kDa.

Background

IL-13R alpha 2, functioning as a monomer, exhibits a robust and specific binding affinity for interleukin-13 (IL13), distinguishing it from interleukin-4 (IL4), to which it does not bind. This selective interaction underscores IL-13R alpha 2's role in mediating cellular responses to IL13, emphasizing its importance in the context of IL13-related biological activities.

Biological Activity

Measured by its binding ability in a functional ELISA. When recombinant human TLR-4 is Immobilized at 2 µg/mL (100 µL/well), can bind Biotinylated MD-2. The ED50 for this effect is 1.491 μg/mL.

  • Measured by its binding ability in a functional ELISA. When recombinant human TLR-4 is Immobilized at 2 µg/mL (100 µL/well),can bind Biotinylated MD-2. The ED50 for this effect is 1.491 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9JHF9 (E19-N160)

Gene ID

17087  [NCBI]

Molecular Construction
N-term
LY96 (E19-N160)
Accession # Q9JHF9
hFc
C-term
Synonyms
Lymphocyte antigen 96; Ly-96; ESOP-1
AA Sequence

EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Molecular Weight

Approximately 47 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MD-2/LY96 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MD-2/LY96 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77081
Quantity:
MCE Japan Authorized Agent: