1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 beta/CCL19
  6. MIP-3 beta/CCL19 Protein, Mouse (sf9, His)

MIP-3 beta/CCL19 Protein, Mouse (sf9, His)

Cat. No.: HY-P7264A
COA Handling Instructions

MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a recombinant mouse MIP-3 beta/CCL19 (M1-S108) protein expressed by Sf9 insect cells with a his tag at the C-terminus.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $205 In-stock
100 μg $575 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a CC chemokine that is strongly chemotactic for CD4 T cells and CD8 T cells and acts as a ligand that binds specifically to the chemokine receptor CCR7 to mediate tissue immunity, inflammatory responses, and antiviral infections. MIP-3 beta/CCL19 Protein, Mouse (sf9, His) is a recombinant mouse MIP-3 beta/CCL19 (M1-S108) protein expressed by Sf9 insect cells with a his tag at the C-terminus[1][2].

Background

CCL19, also known as MIP-3 beta, is an immunostable chemokine that is located on chromosome 9 in the human genome. CCL19 is abundantly expressed in the thymus and lymph nodes, moderately expressed in the trachea and colon, and less expressed in the stomach, small intestine, lung, kidney, and spleen. CCL19 binds to and functions as a chemokine receptor, CCR7. CCR7 is the first CCR7 is the first lymphocyte-specific G protein-coupled receptor (GPCR) identified with seven transmembrane alpha helices. CCR7 is expressed on both double-negative and single-positive thymocytes, including naive T cells, central memory T cells, regulatory T cells, naive B cells, semimature/mature DCs and NK cells, as well as a few tumor cells, where it serves as a key regulator for directing steady-state lymphocytes to secondary lymphoid organs. In contrast, CCL19 is the only chemokine known to effectively stimulate β-arrestin-mediated phosphorylation and internalization of CCR7, leading to receptor desensitization and migration of antigen (Ag)-presenting DCs, thereby affecting T cell responses. The CCL19-CCR7-based signaling pathway plays an important role in tissue immunity and inflammatory response memory. In addition, it also plays a role in vaccine-based protection against a variety of viruses, such as HIV-1 infection, hepatitis C virus (HCV), and herpes simplex virus 1 (HSV-1), etc. The interaction of CCL19 and CCR7 also contributes to the release of antiviral-associated cytokines (e.g., IFN-γ and IL-4) by immune cells, thereby promoting T cell proliferation and DC uptake of antigens[1][2].

In Vitro

CCL19 (1 μg/mL, 6 h) induces T cell proliferation in immature mouse dendritic cells (DC)-T cell co-culture systems, induces upregulation of costimulatory molecules and cytokine production in DCs, and maturation of DC to induce the Th1 response in DC isolated from spleens and mesenteric lymph nodes of naïve BALB/c mice[3].

In Vivo

CCL19 (5 mg/mouse by osmotic pump) significantly increases IL-10 production in plt (plt) mice,and after treatment with 100 mg acetylcholine, the number of lymphocytes at bronchoalveolar lavage fluid (BALF) and enhanced pause (Penh) levels is significantly lower in CCL19-treated mice than in untreated mice[2].
CCL19 can lead to rapid clearance of intrahepatic HBV likely through increased intrahepatic CD8+ T-cell proportion, decreased frequency of PD-1+ CD8+ T cells in blood and compromised suppression of hepatic APCs, with lymphocytes producing a significantly high level of Ag-responsive TNF-α and IFN-γ from CD8+ T cells in C57BL/6 mice transfected with the mouse CCL19-encoding plasmid[4].

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

O70460 (M1-S108)

Gene ID

24047  [NCBI]

Molecular Construction
N-term
CCL19 (M1-S108)
Accession # O70460
His
C-term
Synonyms
C-C motif chemokine 19; SCYA19
AA Sequence

MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Molecular Weight

Approximately 10.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10 % glycerol, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIP-3 beta/CCL19 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 beta/CCL19 Protein, Mouse (sf9, His)
Cat. No.:
HY-P7264A
Quantity:
MCE Japan Authorized Agent: