NKG7 Protein, Mouse (Cell-Free, His)

The NKG7 protein is an important regulator of cytotoxic granule exocytosis and mediates inflammation in infectious and non-infectious diseases. Its important roles include promoting cytotoxic degranulation of NK cells and CD8(+) T cells, activating CD4(+) T cells, and enhancing cytolytic activity through the perforin/granzyme pathway. NKG7 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived NKG7 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of NKG7 Protein, Mouse (Cell-Free, His) is 165 a.a., with molecular weight of 19.5 kDa.

The NKG7 protein functions as a crucial regulator of cytotoxic granule exocytosis in effector lymphocytes, emerging as a pivotal mediator of inflammation in diverse infectious and non-infectious diseases. Its indispensable role is evident in facilitating the cytotoxic degranulation of natural killer (NK) cells and CD8(+) T-cells, as well as activating CD4(+) T-cells in response to infection. Notably, NKG7 plays a critical role in the cytolysis of target cells by CD8(+) T-cells and NK cells, enhancing cytolytic activity through the perforin/granzyme pathway, particularly by promoting the exocytosis of LAMP1-carrying lytic granules. Moreover, NKG7's contribution to NK cell-mediated control of cancer metastasis underscores its broader impact in immune surveillance and response against malignant cells.

Mouse

E. coli Cell-free

N-10*His

Q99PA5 (M1-L165)

/

MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPTSQETQVAGYIHVTQSFCILAVLWGLVSVSFLILSCIPALSAPGRGPLVSTVMAFSAALSILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYETL

19.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.