Platelet factor 4 Protein, Mouse

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. Platelet factor 4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free. The total length of Platelet factor 4 Protein, Mouse is 76 a.a., with molecular weight of ~8.2-12 kDa.

Platelet factor 4 (PF4) is a protein released during platelet aggregation, exerting its influence on various physiological processes. It plays a crucial role in neutralizing the anticoagulant effect of heparin by exhibiting a higher binding affinity to heparin compared to the chondroitin-4-sulfate chains of the carrier molecule. Beyond its anticoagulant properties, PF4 demonstrates chemotactic effects on neutrophils and monocytes, contributing to immune responses. Additionally, PF4 acts to inhibit endothelial cell proliferation, suggesting a role in the regulation of vascular processes. Structurally, PF4 forms a homotetramer, and it interacts with TNFAIP6, specifically engaging with its Link domain. This intricate interplay highlights the multifaceted functions of PF4 in hemostasis, immune response, and vascular regulation.

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100 ng/mL.
2.Measured by its ability to inhibit the FGF basic-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is ≤0.2517 μg/mL, corresponding to a specific activity is ≥3.97×10³ U/mg.

• 
  Measured by its ability to inhibit the FGF basic-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 0.2517 μg/mL, corresponding to a specific activity is 3.97×10³ U/mg.

Mouse

E. coli

Tag Free

Q9Z126 (V30-S105)

56744  [NCBI]

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Approximately 8.2-12 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.