Protein L1/L1R, Vaccinia virus (Sf9, His, myc)

Protein L1/L1R is part of the entry fusion complex (EFC) composed of 11 proteins. This complex facilitates the entry of the virion core into the host cytoplasm through a two-step process: lipid mixing of viral and cellular membranes, followed by pore formation. The assembly or stability of the EFC relies on all proteins except OPG095 and OPG053. Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is the recombinant Virus-derived protein L1/L1R, expressed by Sf9 insect cells , with N-His, C-Myc labeled tag. The total length of Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is 182 a.a., with molecular weight of ~27 kDa.

Protein L1/L1R plays a vital role as a component of the entry fusion complex (EFC), a critical assembly of 11 proteins that facilitates the entry of the virion core into the host cytoplasm during cell infection. The EFC orchestrates this process through a two-step mechanism involving lipid mixing of the viral and cellular membranes, followed by the formation of a pore. Within the EFC, Protein L1/L1R collaborates with other proteins, namely OPG053, OPG076, OPG086, OPG094, OPG099, OPG107, OPG143, OPG104, OPG147, and OPG155. Notably, with the exception of OPG095 and OPG053, each protein within the EFC is indispensable for the assembly or stability of the complex.

Virus

Sf9 insect cells

N-His;C-Myc

P20540 (G2-G183)

/

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG

Approximately 27 kDa

• 
  Greater than 93% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.