1. Recombinant Proteins
  2. Others
  3. RBP1 Protein, Human

RBP1 Protein, Human

Cat. No.: HY-P71093
COA Handling Instructions

RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free. The total length of RBP1 Protein, Human is 134 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free. The total length of RBP1 Protein, Human is 134 a.a., with molecular weight of ~14.0 kDa.

Background

Retinol-Binding Protein 1 (RBP1) is a cytoplasmic protein involved in retinoid homeostasis, acting as a key player in the uptake and storage of retinol. RBP1 functions by accepting retinol from the transport protein STRA6. In its retinol-free apoprotein state, RBP1 interacts with STRA6, facilitating the transfer of retinol and contributing to the regulation of cellular retinoid levels. These interactions and functions highlight the crucial role of RBP1 in maintaining retinol homeostasis and underscore its significance in cellular processes associated with retinoid metabolism.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P09455 (P2-Q135)

Gene ID
Molecular Construction
N-term
RBP1 (P2-Q135)
Accession # P09455
C-term
Synonyms
Retinol-binding protein 1; Cellular retinol-binding protein; CRBP; Cellular retinol-binding protein I; CRBP-I; RBP1; CRBP1
AA Sequence

PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RBP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBP1 Protein, Human
Cat. No.:
HY-P71093
Quantity:
MCE Japan Authorized Agent: