RecO Protein, E.coli (His-SUMO)

RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of RecO Protein, E.coli (His-SUMO) is 242 a.a., with molecular weight of ~43.4 kDa.

RecO protein, a crucial participant in DNA repair and the RecF pathway of recombination, operates as a monomer to execute its functional role. In the intricate landscape of cellular processes, RecO emerges as a key actor, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination within the RecF pathway. Its monomeric form underscores its singular involvement, highlighting its significance in the orchestration of cellular responses to DNA damage and recombination events.

E.coli

E. coli

N-SUMO;N-6*His

P0A7H3 (M1-E242)

947038  [NCBI]

MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Approximately 43.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.