1. Recombinant Proteins
  2. Others
  3. RPE Protein, Mouse (HEK293, His)

RPE Protein, Mouse (HEK293, His)

Cat. No.: HY-P73673
COA Handling Instructions

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag. The total length of RPE Protein, Mouse (HEK293, His) is 228 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag. The total length of RPE Protein, Mouse (HEK293, His) is 228 a.a., with molecular weight of ~27 kDa.

Background

Ribulose-5-phosphate epimerase (RPE) is an enzyme that catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzymatic activity is a key step in the non-oxidative phase of the pentose phosphate pathway, a metabolic pathway essential for the interconversion of sugars and the generation of pentose phosphates. The reversible conversion of ribulose 5-phosphate to xylulose 5-phosphate by RPE contributes to the synthesis of various important cellular components, including nucleotides and coenzymes. The intricate regulation of the pentose phosphate pathway, facilitated by enzymes like RPE, ensures a balanced supply of ribose-5-phosphate for nucleotide biosynthesis and NADPH for redox reactions within the cell. Understanding the functions of RPE provides insights into the regulation of sugar metabolism and its significance in cellular processes.

Biological Activity

Data is not available.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8VEE0 (M1-R228)

Gene ID

66646  [NCBI]

Molecular Construction
N-term
RPE (M1-R228)
Accession # Q8VEE0
His
C-term
Synonyms
Ribulose-Phosphate 3-Epimerase; RPE; HUSSY-17
AA Sequence

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RPE Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RPE Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73673
Quantity:
MCE Japan Authorized Agent: