1. Recombinant Proteins
  2. Others
  3. S100A9 Protein, Mouse (His)

S100A9 Protein, Mouse (His)

Cat. No.: HY-P74583
COA Handling Instructions

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes. S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2. S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response. S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A9 Protein, Mouse (His) is 112 a.a., with molecular weight of 16-20 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg $47 In-stock
10 μg $80 In-stock
50 μg $220 In-stock
100 μg $380 In-stock
500 μg $1060 In-stock
1 mg $1800 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

S100A9 Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE S100A9 Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes. S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2. S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response. S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A9 Protein, Mouse (His) is 112 a.a., with molecular weight of 16-20 kDa.

Background

S100A9 is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes. S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. S100A9 promotes leukocyte arachidonic acid transport and metabolism, tubulin-dependent cytoskeletal regulation during phagocyte migration and activation of the neutrophilic NADPH oxidase. S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities.S100A9 acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors and receptor for advanced glycation endproducts (AGER). S100A9 binds to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways, leading to amplification of the pro-inflammatory cascade. S100A9 has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. S100A9 can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. S100A9 plays an important role in the regulation of inflammatory processes and immune response[1][2][3][4][5][6][7].

Biological Activity

Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells .The ED50 for this effect is 0.4264-0.8299 μg/mL, corresponding to a specific activity is 1.20× 103-2.345 × 103 units/mg.

  • Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.8299 μg/mL, corresponding to a specific activity is 1.20× 103 units/mg determined by qRT-PCR.
  • Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.4264 μg/mL, corresponding to a specific activity is 2.345 × 103 units/mg determined by ELISA.
Species

Mouse

Source

E. coli

Tag

N-His

Accession

P31725 (A2-K113)

Gene ID

20202  [NCBI]

Molecular Construction
N-term
His
S100A9 (A2-K113)
Accession # P31725
C-term
Synonyms
Protein S100-A9; Calgranulin-B; MRP-14; CAGB; CFAG
AA Sequence

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

Molecular Weight

16-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. The specifaction of 5/10/50/100/500/1000 μg is recommended to reconstitute to a concentration of200/200/500/500/2000/2000 μg/mL in sterilized water respectively. For concentration less than that, pleasereconstitute in 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 buffer.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A9 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A9 Protein, Mouse (His)
Cat. No.:
HY-P74583
Quantity:
MCE Japan Authorized Agent: