SARS-CoV-2 PLpro Protein

The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free. The total length of SARS-CoV-2 PLpro Protein is 315 a.a., with molecular weight of ~34.0 kDa.

The SARS-CoV-2 PP1ab protein is a multifunctional component crucial for the transcription and replication of viral RNAs, housing the proteinases responsible for polyprotein cleavages. This protein plays a pivotal role in inhibiting host translation by associating with the open head conformation of the 40S subunit, and its C-terminus obstructs the ribosomal mRNA entry tunnel, thereby impeding the antiviral response triggered by innate immunity or interferons. The formation of the nsp1-40S ribosome complex leads to an endonucleolytic cleavage near the 5'UTR of host mRNAs, facilitating their degradation. Notably, viral mRNAs exhibit greater resistance to the nsp1-mediated inhibition of translation due to their 5'-end leader sequence. This multifaceted functionality underscores the strategic role of SARS-CoV-2 PP1ab in manipulating host cellular processes for the benefit of viral replication and evasion of host defenses.

Measured by its ability to cleave a fluorogenic peptide substrate, Arg-Leu-Arg-Gly-Gly-AMC (RLRGGAMC).The Specific Activity is 449 pmol/min/μg, as measured under the described conditions.

Virus

E. coli

Tag Free

P0DTD1-1 (E1564-K1878)

43740578  [NCBI]

EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 10 mM 2-Mercaptoethanol, 20% Glycerol, pH 7.5.

N/A

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.