SDC4 Protein, Mouse (HEK293, His)

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis. SDC4 exists as a homodimer and engages in important interactions with various intracellular partners. SDC4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SDC4 Protein, Mouse (HEK293, His) is 122 a.a., with molecular weight of ~22.21 kDa.

Syndecan-4 (SDC4) is a cell surface proteoglycan that plays a crucial role in regulating exosome biogenesis in collaboration with SDCBP and PDCD6IP. As a homodimer, SDC4 engages in various protein interactions, including binding with CDCP1 and SDCBP, suggesting its involvement in diverse cellular processes. Through its cytoplasmic domain, SDC4 forms interactions with GIPC, specifically through the PDZ domain, and with NUDT16L1. These associations highlight the multifunctional nature of SDC4, suggesting its participation in intricate cellular signaling pathways and the regulation of exosome dynamics.

Mouse

HEK293

C-6*His

O35988 (E24-E145)

20971  [NCBI]

ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTE

Approximately 22.21 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.