1. Recombinant Proteins
  2. Others
  3. SHH Protein, Mouse (C25II)

SHH Protein, Mouse (C25II)

Cat. No.: HY-P7409
COA Handling Instructions

SHH Protein, Mouse (C25II) is a recombinant mouse sonic hedgehog variant.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $380 In-stock
100 μg $600 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SHH Protein, Mouse (C25II)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SHH Protein, Mouse (C25II) is a recombinant mouse sonic hedgehog variant.

Background

Sonic Hedgehog (SHH) is a secreted factor. The protein is heavily modified through cleavage and posttranslational modification and its release from producing cells can also be modulated by interactions with Dispatched, Scube2, and heparan sulfate proteoglycan. Sonic hedgehog (SHH) is the main ligand of hedgehog (Hh) pathway in mouse[1][2].

Biological Activity

The ED50 is <2 μg/mL as measured by C3H/10T1/2 (CCL-226) cells, corresponding to a specific activity of >500 units/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q62226 (C25-G198, C25II)

Gene ID

20423  [NCBI]

Molecular Construction
N-term
SHH (C25-G198, C25II)
Accession # Q62226
C-term
Synonyms
rMuSonic Hedgehog, C25II; Hhg1
AA Sequence

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Weight

Approximately 19.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

SHH Protein, Mouse (C25II) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SHH Protein, Mouse (C25II)
Cat. No.:
HY-P7409
Quantity:
MCE Japan Authorized Agent: