SYP/Synaptophysin Protein, Rat (Cell-Free, His)

The SYP/synaptophysin protein may have a dual role: organizing membrane components and aiding in vesicle targeting. Its role in the regulation of synaptic plasticity emphasizes its importance in shaping synaptic activity. SYP/Synaptophysin Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYP/Synaptophysin protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SYP/Synaptophysin Protein, Rat (Cell-Free, His) is 307 a.a., with molecular weight of 34.8 kDa.

SYP/Synaptophysin Protein appears to play a dual role, potentially participating in structural functions by organizing other membrane components or facilitating the targeting of vesicles to the plasma membrane. Its involvement in the regulation of both short-term and long-term synaptic plasticity underscores its significance in shaping synaptic activity. Existing as a homohexamer or homotetramer, SYP interacts with SRCIN1 and VAMP2, the latter interaction being regulated by VAPM2 and inhibited by the interaction of VAPM2 with SEPT8. These intricate interactions highlight SYP's role in the molecular orchestration of synaptic processes, emphasizing its potential impact on synaptic structure and function.

Rat

E. coli Cell-free

N-10*His

P07825 (M1-M307)

24804

MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM

34.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.