TPM4 Protein, Human (HEK293, His)

TPM4 protein, binding actin filaments in muscle and non-muscle cells, crucially regulates calcium-dependent muscle contraction, aided by the troponin complex in vertebrates. In smooth muscle cells, TPM4 interacts with caldesmon, contributing to contraction regulation. In non-muscle cells, it stabilizes actin filaments in the cytoskeleton. TPM4's calcium-binding ability, homodimer, and heterodimer formation (with alpha and beta chains) showcase its versatile molecular configurations. TPM4's multifaceted interactions emphasize its essential roles in muscle contraction and cytoskeletal dynamics across diverse cellular contexts. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293, with N-His, N-6*His labeled tag. The total length of TPM4 Protein, Human (HEK293, His) is 247 a.a., with molecular weight of 35-40 kDa.

TPM4 protein exhibits binding specificity to actin filaments in both muscle and non-muscle cells, playing a pivotal role, particularly in conjunction with the troponin complex, in the calcium-dependent regulation of striated muscle contraction in vertebrates. In smooth muscle cells, TPM4 contributes to the regulation of contraction through interaction with caldesmon. In non-muscle cells, TPM4 is implicated in stabilizing actin filaments within the cytoskeleton. Additionally, TPM4 has a calcium-binding capacity, as demonstrated in studies. It forms homodimers and heterodimers, the latter composed of an alpha chain (TPM1, TPM3, or TPM4) and a beta chain (TPM2), showcasing its versatility in molecular configurations. The multifaceted interactions of TPM4 underscore its essential roles in both muscle contraction and cytoskeletal dynamics across diverse cellular contexts.

Human

HEK293

N-His;N-6*His

P67936 (A2-I248)

7171  [NCBI]

AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

35-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.