1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Deubiquitinase
  4. UCH Proteins
  5. UCH-L3
  6. UCHL3 Protein, Mouse (His, solution)

UCHL3 Protein, Mouse (His, solution)

Cat. No.: HY-P76119A
COA Handling Instructions

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag. The total length of UCHL3 Protein, Mouse (His, solution) is 229 a.a., with molecular weight of ~26 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg $295 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag. The total length of UCHL3 Protein, Mouse (His, solution) is 229 a.a., with molecular weight of ~26 kDa.

Background

UCHL3 Protein is a deubiquitinating enzyme (DUB) that plays a crucial role in controlling the levels of cellular ubiquitin by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, it specifically recognizes and hydrolyzes the peptide bond at the C-terminal glycine of ubiquitin or NEDD8. UCHL3 Protein exhibits a preference for 'Lys-48'-linked ubiquitin chains and has a 10-fold preference for Arg and Lys at position P3''. Its deubiquitinating activity includes the deubiquitination of ENAC in apical compartments, regulating the recycling of the apical membrane. Additionally, UCHL3 Protein indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, thereby promoting insulin signaling and insulin-induced adipogenesis. It is also essential for stress-response retinal, skeletal muscle, and germ cell maintenance. Furthermore, UCHL3 Protein may be involved in working memory and can hydrolyze UBB(+1), a mutated form of ubiquitin that is resistant to degradation by the proteasome.

Biological Activity

Data is not available.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

Q9JKB1 (E2-A230)

Gene ID

50933

Molecular Construction
N-term
His
UCHL3 (E2-A230)
Accession # Q9JKB1
C-term
Synonyms
UCH-L3; Ubiquitin thioesterase L3; Uchl3
AA Sequence

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Weight

Approximately 26 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 20% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UCHL3 Protein, Mouse (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCHL3 Protein, Mouse (His, solution)
Cat. No.:
HY-P76119A
Quantity:
MCE Japan Authorized Agent: