2. GPCR/G Protein
  3. GHSR
  4. GHRF, bovine

GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GHRF, bovine Chemical Structure

GHRF, bovine Chemical Structure

CAS No. : 88894-91-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

GHRF, bovine Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone (HY-N0583)[1][2].

In Vitro

GHRF, bovine (0.001 nM-100 nM; 6 h) increases growth hormone (GH) release from bovine anterior pituitary cells, with maximum release of 262% above control at 100 nM[1].
GHRF, bovine (0.0001 nM-100 nM; 24 h) linearly increases GH secretion and is enhanced by Hydrocortisone (HY-N0583) (Cortisol, 10 ng/mL) in anterior pituitary cells cultured in media containing fetal calf serum (FCS)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

GHRF, bovine Related Antibodies
In Vivo

GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) has no influence on the mRNA abundance of the liver-type glucose transporter in the liver or kidney of postpartum bovine[2].
GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) also doesn’t alter the mRNA abundance of the erythrocyte-type or the intestinal-type glucose transporter in the kidney of postpartum bovine, but results individual differences in the mRNA abundance of the intestinal-type glucose transporter in liver[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight

5104.72

Formula

C220H366N72O66S
CAS No.
Sequence Shortening

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

GHRF, bovine Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GHRF, bovine88894-91-1bGRF(1-44)-NH2GHSRGrowth hormone secretagogue receptorGhrelin receptorfetal calf serumFCSgrowth hormoneGHGH-releasing factorbovineInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GHRF, bovine
Cat. No.:
HY-P3607
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.