From 11:00 pm to 12:00 pm EST ( 8:00 pm to 9:00 pm PST ) on January 6th, the website will be under maintenance. We are sorry for the inconvenience. Please arrange your schedule properly.
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions .
ACE Human Pre-designed siRNA Set A contains three designed siRNAs for ACE gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
Ace Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ace gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACE Rat Pre-designed siRNA Set A contains three designed siRNAs for ACE gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits Smad2/3 signaling. Luspatercept can be used for the research of anemia .
ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACE2 Rat Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACER1 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACER2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
ACER3 Human Pre-designed siRNA Set A contains three designed siRNAs for ACER3 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
Acetyl tetrapeptide-5 inhibits glycosylation and ACE-1 activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care .
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .
Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme(ACE) inhibitor with an IC50 value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an Ki value of 1.675 μM .
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure .
Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme(ACE, HY-P2983) .
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.
NH2-AKK-COOH, a synthetic tripeptide, is an ACE inhibitor, with IC50s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively .
Quinaprilat hydrate is a non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat hydrate specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat hydrate acts as anti-hypertensive agent and vasodilator .
Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator .
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits .
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits .
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits .
Perindoprilat-d3 disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC50 value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .
Indolapril hydrochloride (CI-907) is an orally active nonsulfhydryl angiotensin converting enzyme (ACE) inhibitor. Indolapril hydrochloride is highly specific in suppressing the contractile or pressor responses to Angiotensin I. Indolapril hydrochloride is a potent antihypertensive agent .
Ramiprilat-d4 hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .
Resorcinolnaphthalein is a specific angiotensin-converting enzyme 2 (ACE2) enhancer and activates ACE2 activity with an EC50 value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis .
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Sodium new houttuyfonate (SNH) is a partially reversible NDM-1 inhibitor with an IC50 of 14.2 μM. Sodium new houttuyfonate is an inhibitor against renin and angiotensin I converting enzyme (ACE). Sodium new houttuyfonate can recover the antibacterial activity of Meropenem (HY-13678) against E. coli BL21/pET15b-blaNDM-1 .
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a Ki of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC50 of 2.5 nM .
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC50 value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens .
IC50: 505.9 µM (ACE)
DX600 is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .
SARS-CoV-2-IN-65 (compound 2f (81)) is a potent,orally active and reversible SARS-CoV-2 entry inhibitor. SARS-CoV-2-IN-65 inhibits the pseudovirus entry in a ACE2-dependent pathway, via mainly inhibiting RBD:ACE2 interaction and TMPRSS2 activity in Calu-3 cells .
DX600 TFA is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .
MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
MAT-POS-e194df51-1 is an orally active, non-covalent and non-peptide SARS-CoV-2 main protease (M pro) inhibitor with an IC50 value of 37nM. MAT-POS-e194df51-1 is cytotoxic with EC50 values of 64 nM and 126 nM in A549-ACE2-TMPRSS2 cells and HeLa -ACE2 cells, respectively .
Spirapril is a potent and cross the blood-brain barrier angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure .
BML-111, a lipoxin A4 analog, is a lipoxin A4 receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties .
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).
TD-0212 (compound 35) is an orally active dual pharmacology angiotensin II type 1 receptor (AT1) antagonist and neprilysin (NEP) inhibitor, with a pKi of 8.9 for AT1 and a pIC50 of 9.2 for NEP .
TD-0212 TFA is an orally active dual pharmacology angiotensin II type 1 receptor (AT1) antagonist and neprilysin (NEP) inhibitor, with a pKi of 8.9 for AT1 and a pIC50 of 9.2 for NEP .
Delapril-d3 (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].
Zabicipril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Zabicipril can be used for the study of blood pressure and peripheral arterial insufficiency .
Sampatrilat (UK-81252) is a potent and orally active vasopeptidase inhibitor of ACE and neutral endopeptidase (NEP). Sampatrilat inhibits C-domain ACE (Ki=13.8 nM) 12.4-fold more potent than that for the N-domain (Ki=171.9 nM). Sampatrilat (UK-81252) can be used for the study of chronic heart failure and blood pressure regulation .
Dihydroconiferyl alcohol is a cell division factor that can be found in pring sap of Acer pseudoplatanus L. Dihydroconiferyl alcohol can stimulate growth of soybean callus .
ML2006a4 is an orally active inhibitor for SARS-CoV-2 main protease (M pro) with IC50 in picomolare value. ML2006a4 is cell permeable and antiviral active, that inhibits replication in SARS-CoV-2 in cells Huh7.5.1-ACE2-TMPRSS2 (Huh7.5.1++) in picomolare level
Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
Moexipril is an orally active inhibitor of angiotensin-converting enzyme(ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril exhibits antihypertensive and neuroprotective effects - .
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay .
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of CathepsinA .
Oleacein (Compound 9) is an ACE inhibitor that can be isolated from J. grandiflorum. Oleacein is orally active and can be used in the study of metabolic and cardiovascular diseases .
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM . Antihypertensive tripeptides .
Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels .
Moexipril hydrochloride (RS-10085) is an orally active inhibitor of angiotensin-converting enzyme(ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril hydrochloride exhibits antihypertensive and neuroprotective effects - .
Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC50 value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .
Trandolapril-d5 is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension .
Temocapril hydrochloride is an orally active angiotensin-converting enzyme(ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases .
Spiraprilat is a potent angiotensin-converting enzyme (ACE) inhibitor. Spiraprilat has ability to improve left ventricular (LV) function and metabolism in anesthetized open-chest dogs with acute ventricular failure (ALVF) .
Temocapril is an orally active angiotensin-converting enzyme(ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases .
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase .
Rhododendrol can induce leukoderma. Rhododendrol induces generation of hydroxyl radicals and melanocyte cytotoxicity by increasing glutathione levels. Rhododendrol is a phenolic compound that can be isolated from plants such as Acer nikoense and Betula platyphylla .
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .
Imidaprilate-d5 is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
Trandolaprilate hydrate is a potent angiotensin-converting enzyme(ACE) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .
Trandolaprilate is a potent angiotensin-converting enzyme(ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .
Vasicinol is a reversible inhibitor of sucrase (IC50: 250 μM). Vasicinol is a HbF inducer. Vasicinol also inhibits Angiotensin-converting Enzyme (ACE). Vasicinol is apyrroquinazoline alkaloid that can be isolated from Adhatoda vasica .
Garcinone B, a xanthone derivative, is a nature product that could be isolated from the pericarp of Mangosteen. Garcinone B is a potent ACE2 and Mpro inhibitor. Garcinone B can be used in research of COVID-19 .
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
Moexipril-d5 is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent angiotensin-converting enzyme (ACE) inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .
2"-O-Galloylquercitrin (Compound 6) is
isolated from the natural Acer ginnala. 2"-O-Galloylquercitrin
has health benefits. 2"-O-Galloylquercitrin has the activity of free
radical scavenger .
Imidapril-d3 (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].
Temocaprilat (Temocapril diacid) is an inhibitor of angiotensin-converting enzyme(ACE). Temocaprilat alleviates the inhibitory effect of high glucose on the proliferation of aortic endothelial cells. Temocaprilat has potential applications in hypertension and vascular inflammation .
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium .
SSAA09E2 is an inhibitor of SARS-CoV (Severe acute respiratory syndrome-Coronavirus) replication, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2) .
Enalaprilat (MK-422 anhydrous), the active metabolite of the oral proagent Enalapril, is a potent, competitive and long-acting angiotensin-converting enzyme (ACE) inhibitor, with an IC50 of 1.94 nM. Enalaprilat can be used for the research of hypertension .
Moexipril-d3 is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of angiotensin-converting enzyme(ACE), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects - .
Enalaprilat dihydrate (MK-422), the active metabolite of the oral proagent Enalapril, is a potent, competitive and long-acting angiotensin-converting enzyme (ACE) inhibitor, with an IC50 of 1.94 nM. Enalaprilat dihydrate can be used for the research of hypertension .
Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI) .
Temocapril-d5 is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment .
Captopril EP Impurity B is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) .
Captopril EP Impurity E is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) .
Captopril EP Impurity C is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) .
Captopril EP Impurity D is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) .
Captopril EP Impurity J is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) .
Methylprednisolone-d3 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d4 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d7 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Psoromic acid is a potent and selective RabGGTase (Rab geranylgeranyl transferase) inhibitor with an IC50 value of 1.3 µM. Psoromic acid is an antioxidative agent. Psoromic acid exhibits a competitive type of HMGR inhibition and mixed type of ACE (angiotensin converting enzyme) inhibition .
Isocrenatoside (compound 6) is a cyclic octapeptide and an inhibitor of angiotensin-converting enzyme (ACE). Isocrenatoside is isolated from the ethanolic extract of Microtoena prainiana stems. Studies have found that the inhibitory efficiency of 1 mg/mL Isocrenatoside can reach 99.3% .
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the Angiotensin-Converting Enzyme (ACE), with the IC50 of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE), implicating in Alzheimer’s diseases .
Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium .
Vicenin 2, a flavonoid, is an orally active angiotensin-converting enzyme (ACE) inhibitor (IC50 of 43.83 μM) . Vicenin 2 has radioprotective, anti-nociceptive effects, anti-glycation anti-inflammatory, antioxidant, anticancer, antiangiogenic properties .
Methylprednisolone-d2 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].
Trandolapril (RU44570) hydrochloride is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolapril hydrochlorideat. Trandolapril hydrochloride is an orally active angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI) .
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19 .
Methylprednisolone (Standard) is the analytical standard of Methylprednisolone. This product is intended for research and analytical applications. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels .
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the ACE2 PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity .
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 μM .
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .
Ramiprilat-d5 is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].
H-Tyr-Tyr-OH (L-Tyrosyl-L-tyrosine) is an antihypertensive peptide. H-Tyr-Tyr-OH inhibits angiotensin I-converting enzyme (ACE) with an IC50 value of 0.028 mg/mL. H-Tyr-Tyr-OH can be used for the research of high blood pressure .
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a Km value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC50 of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC50 values of 3.5, 0.034, and 78 μM, respectively .
Trandolaprilate-d6 is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC50 of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC50 values of 3.5, 0.034, and 78 μM, respectively .
Quinaprilat-d5 is a deuterium-labeled Quinaprilat. Quinaprilat is a nonsulfhydryl ACE inhibitor, the active diacid metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits bradykinin degradation. Quinaprilat primarily acts as a vasodilator, decreasing total peripheral and renal vascular resistance[1].
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population .
CMX990 is a SARS-CoV-2 3CL protease inhibitor. The EC90s for inhibiting SARS-CoV-2 were 9.6 nM and 101 nM in human bronchial epithelial cells (HBECs) and HeLa-ACE2 cells, respectively. CMX990 has good ADME and pharmacokinetic properties .
Zofenopril Calcium (SQ26991) is an orally active angiotensin-converting enzyme (ACE) inhibitor with antioxidant activity and cardioprotective effects. Zofenopril Calcium reduces ROS production and GSH consumption and helps inhibit foam cell formation, thus slowing the progression of atherosclerosis. Zofenopril Calcium prevents cardiac damage caused by chronic Doxorubicin (HY-15142A).
Imidapril hydrochloride (TA-6366) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril hydrochloride suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril hydrochloride can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research .
Imidapril (TA-6366 free base) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research .
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity .
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC50 of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC50 of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC50 of 52 µM .
Benazeprilat is an orally active and the active metabolite of benazepril, a carboxyl-containing ACE inhibitor with antihypertensive activity. Benazepril is a well-established antihypertensive agent, both in monoresearch and in combination with other classes of drugs including thiazide diuretics and calcium channel blockers. Benazepril is a first-line research in reducing various pathologies associated with CV risk and secondary end-organ damage .
Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM .
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis . (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection .
Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties .
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC50 of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .
Captopril (SQ 14225) hydrochloride, antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril hydrochloride is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM .
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .
BMS-265246 is a potent and selective cyclin-dependent kinaseCDK1 and CDK2 inhibitor, with IC50 values of 6 and 9 nM, respectively. BMS-265246 inhibits CHI3L1 (chitinase 3-like-1) stimulation of ACE2 (angiotensin converting enzyme 2) and SPP (viral spike protein priming proteases). BMS-265246 can be used for ovarian cancer and COVID-19 research .
Captopril-d3 is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of Angiotensin converting enzyme(ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells .
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .
Sinapinic acid (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Rhizome, acts as an inhibitor of HDAC, with an IC50 of 2.27 mM , and also inhibits ACE-I activity . Sinapinic acid posssess potent anti-tumor activity, induces apoptosis of tumor cells . Sinapinic acid shows antioxidant and antidiabetic activities . Sinapinic acid reduces total cholesterol, triglyceride, and HOMA-IR index, and also normalizes some serum parameters of antioxidative abilities and oxidative damage in ovariectomized rats .
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
SARS-CoV-2 3CLpro-IN-23 (Compound Cd3) is a compound that can be isolated from Citrus depressa. SARS-CoV-2 3CLpro-IN-23 has good inhibitory activity to the SARS-CoV-2 spike protein, with KD of 0.79 μM. SARS-CoV-2 3CLpro-IN-23 can bind to key amino acid residue, disrupting the formation of the spike protein and h-ACE2 complex .
SARS-CoV-2-IN-81 (compound 12e) is a potent AAK1 inhibitor with an IC50 value of 9.38 nM. SARS-CoV-2-IN-81 shows anti-viral property against SARS-CoV-2. SARS-CoV-2-IN-81 attenuates AAK1-induced phosphorylation of AP2M1 threonine 156 and disrupts the direct interaction between AP2M1 and ACE2, ultimately inhibiting SARS-CoV-2 infection .
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
Ursodeoxycholic acid-2,2,4,4-d4 is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].
COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.
Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1475 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 μM .
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .
ACE-031 (Myostatin inhibitory peptide 7) is a recombinant protein comprised of activin receptor type IIB (ActRIIB) linked to the Fc region of human immunoglobulin IgG1. ACE-031 exhibits inhibitory activity against myostatin and other negative regulators of muscle mass, promotes muscle growth .
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme(ACE, HY-P2983) .
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.
NH2-AKK-COOH, a synthetic tripeptide, is an ACE inhibitor, with IC50s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively .
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
DX600 is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .
DX600 TFA is a selective ACE2 specific inhibitor (KD: 1.3 nM), and does not cross-react with ACE. DX600 TFA exacerbates diabetes-induced cardiovascular dysfunction and the increase in cardiac and renal NOX activity .
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay .
Abz-Gly-p-nitro-Phe-Pro-OH is the fluorescent substrate angiotensin I converting enzyme (ACE-I) with 355 nm excitation and 405 nm emission wavelengths .
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of CathepsinA .
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM . Antihypertensive tripeptides .
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension .
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase .
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent angiotensin-converting enzyme (ACE) inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium .
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the Angiotensin-Converting Enzyme (ACE), with the IC50 of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE), implicating in Alzheimer’s diseases .
SBP1 peptide is a chemically synthesized 23-mer peptide fragment of the ACE2 PD α1 helix. SBP1 peptide associates with micromolar affinity to insect-derived SARS-CoV-2-RBD protein .
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity .
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a Km value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of Angiotensin converting enzyme(ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells .
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions .
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits Smad2/3 signaling. Luspatercept can be used for the research of anemia .
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment .
Efmitermant alfa (ACE-083) is a locally acting, follistatin-based fusion protein. Efmitermant alfa also is a muscle-promoting agent. Efmitermant alfa can be used for the research of muscle disorders .
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with ACE2 for viral entry. Regdanvimab can be used for the research of COVID-19 .
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .
Sodium new houttuyfonate (SNH) is a partially reversible NDM-1 inhibitor with an IC50 of 14.2 μM. Sodium new houttuyfonate is an inhibitor against renin and angiotensin I converting enzyme (ACE). Sodium new houttuyfonate can recover the antibacterial activity of Meropenem (HY-13678) against E. coli BL21/pET15b-blaNDM-1 .
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC50 value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens .
IC50: 505.9 µM (ACE)
Dihydroconiferyl alcohol is a cell division factor that can be found in pring sap of Acer pseudoplatanus L. Dihydroconiferyl alcohol can stimulate growth of soybean callus .
Oleacein (Compound 9) is an ACE inhibitor that can be isolated from J. grandiflorum. Oleacein is orally active and can be used in the study of metabolic and cardiovascular diseases .
Trandolaprilate hydrate is a potent angiotensin-converting enzyme(ACE) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .
Garcinone B, a xanthone derivative, is a nature product that could be isolated from the pericarp of Mangosteen. Garcinone B is a potent ACE2 and Mpro inhibitor. Garcinone B can be used in research of COVID-19 .
2"-O-Galloylquercitrin (Compound 6) is
isolated from the natural Acer ginnala. 2"-O-Galloylquercitrin
has health benefits. 2"-O-Galloylquercitrin has the activity of free
radical scavenger .
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium .
Psoromic acid is a potent and selective RabGGTase (Rab geranylgeranyl transferase) inhibitor with an IC50 value of 1.3 µM. Psoromic acid is an antioxidative agent. Psoromic acid exhibits a competitive type of HMGR inhibition and mixed type of ACE (angiotensin converting enzyme) inhibition .
Isocrenatoside (compound 6) is a cyclic octapeptide and an inhibitor of angiotensin-converting enzyme (ACE). Isocrenatoside is isolated from the ethanolic extract of Microtoena prainiana stems. Studies have found that the inhibitory efficiency of 1 mg/mL Isocrenatoside can reach 99.3% .
Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium .
Vicenin 2, a flavonoid, is an orally active angiotensin-converting enzyme (ACE) inhibitor (IC50 of 43.83 μM) . Vicenin 2 has radioprotective, anti-nociceptive effects, anti-glycation anti-inflammatory, antioxidant, anticancer, antiangiogenic properties .
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine ACE activity (IC50=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity .
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC50 of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC50 values of 3.5, 0.034, and 78 μM, respectively .
Punicalin is a species that can be isolated from the leaves of Punica granatum. Punicalin is an active molecule against hepatitis b virus (HBV). Punicalin can induce pyroptosis. Punicalin is a Carbonic anhydrase inhibitor. Punicalin blocks the binding of S-glycoprotein and ACE2 receptors. Pnuicalin has anti-inflammatory, antioxidant and antiviral activity .
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC50 of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC50 of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC50 of 52 µM .
Benazeprilat is an orally active and the active metabolite of benazepril, a carboxyl-containing ACE inhibitor with antihypertensive activity. Benazepril is a well-established antihypertensive agent, both in monoresearch and in combination with other classes of drugs including thiazide diuretics and calcium channel blockers. Benazepril is a first-line research in reducing various pathologies associated with CV risk and secondary end-organ damage .
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis . (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces ACE2 expression and SARS-CoV-2 infection .
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC50 of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .
Sinapinic acid (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Rhizome, acts as an inhibitor of HDAC, with an IC50 of 2.27 mM , and also inhibits ACE-I activity . Sinapinic acid posssess potent anti-tumor activity, induces apoptosis of tumor cells . Sinapinic acid shows antioxidant and antidiabetic activities . Sinapinic acid reduces total cholesterol, triglyceride, and HOMA-IR index, and also normalizes some serum parameters of antioxidative abilities and oxidative damage in ovariectomized rats .
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 723 a.a., with molecular weight of 115-125 kDa.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of ACE2 Protein, Human (sf9, His) is 740 a.a., with molecular weight of ~85.1 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-His, C-Avi labeled tag. The total length of ACE2 Protein, Cynomolgus (HEK293, His-Avi) is 722 a.a., with molecular weight of 95-110 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 722 a.a., with molecular weight of 87-110 kDa.
ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.
ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Rhesus Macaque (HEK293, Fc) is 739 a.a., with molecular weight of ~110.7 kDa.
ACE2 Protein, a crucial carboxypeptidase in the renin-angiotensin system, regulates blood volume and vascular resistance, maintaining cardiovascular homeostasis. It converts angiotensin I to anti-hypertrophic angiotensin 1-9 and angiotensin II to vasodilatory angiotensin 1-7, countering vasoconstriction. ACE2 also regulates amino acid transport, interacting with SLC6A19, and modulates vasoactive peptides like neurotensin and kinetensin. Its multifaceted functions make ACE2 pivotal in cardiovascular and amino acid homeostasis. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293, with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.
ACE/CD143 Protein, Human (His) is a recombinant human Angiotensin-converting enzyme/CD143 a His tag at the C-terminus. Angiotensin I-converting enzyme (ACE, CD143) hydrolyzes small peptides such as angiotensin I, bradykinin, substance P, LH-RH and several others and thus plays a key role in blood pressure regulation and vascular remodeling. ACE plays a crucial role in blood pressure regulation, vascular remodeling, and immunity.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag. The total length of ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is 740 a.a., with molecular weight of ~86.86 kDa.
ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (740a.a, HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Human (740a.a, HEK293, His) is 723 a.a., with molecular weight of ~85.1 kDa.
ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.
ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.
ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.
The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag. The total length of ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is 723 a.a., with molecular weight of 114.9 kDa.
ACE2 Protein, Human (HEK293, His) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.
Avian influenza virus (AIV) belongs to the genus Orthomyxovirus and contains eight single-stranded negative-sense RNA segments (PB2, PB1, PA, HA, NP, NA, M, and NS). The haemagglutinin (HA) protein presents as a homotrimer in which each monomer consists of two di-sulfide-linked HA1 and HA2 subunits after the cleavage of the HA0 precursor. The HA protein, which is responsible for receptor binding and membrane fusion, plays a key role in the influenza virus entry pathway. HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag. The total length of HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His) is 344 a.a., with molecular weight of ~37.9 kDa.
Avian influenza virus (AIV) belongs to the genus Orthomyxovirus and contains eight single-stranded negative-sense RNA segments (PB2, PB1, PA, HA, NP, NA, M, and NS). The haemagglutinin (HA) protein presents as a homotrimer in which each monomer consists of two di-sulfide-linked HA1 and HA2 subunits after the cleavage of the HA0 precursor. The HA protein, which is responsible for receptor binding and membrane fusion, plays a key role in the influenza virus entry pathway. HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His) is the recombinant Virus-derived HA1/Hemagglutinin protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His) is 344 a.a., with molecular weight of ~37.9 kDa.
The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His) is 529 a.a., with molecular weight of ~65 kDa.
The hemagglutinin (HA) protein attaches viral particles to host cells by binding to sialic acid-containing receptors and induces viral particle internalization through clathrin-dependent endocytosis. HA also promotes an alternative clathrin- and caveolin-independent pathway for some virions. HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His) is the recombinant Virus-derived HA/Hemagglutinin protein, expressed by HEK293 , with C-His labeled tag. The total length of HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His) is 344 a.a., with molecular weight of 45-55 kDa.
Perindoprilat-d3 disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC50 value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .
Ramiprilat-d4 hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .
Delapril-d3 (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].
Imidaprilate-d5 is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
Moexipril-d5 is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].
Imidapril-d3 (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].
Moexipril-d3 is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of angiotensin-converting enzyme(ACE), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects - .
Temocapril-d5 is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].
Methylprednisolone-d3 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d4 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d7 is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].
Methylprednisolone-d2 is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].
Ramiprilat-d5 is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].
Trandolaprilate-d6 is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].
Quinaprilat-d5 is a deuterium-labeled Quinaprilat. Quinaprilat is a nonsulfhydryl ACE inhibitor, the active diacid metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits bradykinin degradation. Quinaprilat primarily acts as a vasodilator, decreasing total peripheral and renal vascular resistance[1].
Captopril-d3 is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].
Emodin-d4 is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].
Ursodeoxycholic acid-2,2,4,4-d4 is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].
ACE Antibody is an unconjugated, approximately 147 kDa, rabbit-derived, anti-ACE polyclonal antibody. ACE Antibody can be used for: WB, ELISA, IHC-P, IHC-F, ICC, IF expriments in human, mouse, rat, and predicted: dog, pig, cow, sheep background without labeling.
ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.
Inquiry Online
Your information is safe with us. * Required Fields.